Entry information : AruPrx22 (HRP_22684.1 / HRP_22684.2)
Entry ID 12922
Creation 2014-06-12 (Christophe Dunand)
Last sequence changes 2014-06-12 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2014-06-12 (Christophe Dunand)
Peroxidase information: AruPrx22 (HRP_22684.1 / HRP_22684.2)
Name (synonym) AruPrx22 (HRP_22684.1 / HRP_22684.2)
Class Class III peroxidase    [Orthogroup: Prx039]
Taxonomy Eukaryota Viridiplantae Streptophyta Brassicaceae Armoracia
Organism Armoracia rusticana (horseradish)    [TaxId: 3704 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AruPrx22
start..stop
S start..stop
AruPrx23 621 0 1..349 1..349
AhalPrx38 612 0 1..349 1..349
AlyPrx22 609 0 1..349 1..349
AtPrx22 607 0 1..349 1..349
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 4..231 228 N° 2 388..579 192 N° 3 670..838 169 N° 4 1194..1654 461
join(4..231,388..579,670..838,1194..1654)


exon

Literature and cross-references AruPrx22 (HRP_22684.1 / HRP_22684.2)
Literature REFERENCE 2 Naatsaari,L., Krainer,F.W., Schubert,M., Glieder,A. and Thallinger,G.G. Peroxidase gene discovery from the horseradish transcriptome . BMC Genomics 15 (1), 227 (2014)
Protein ref. UniProtKB:   K7ZW29   K7ZWW8 [Mismatch]
DNA ref. GenBank:   HE963811.1   HE963810.1 [Mismatch]
Protein sequence: AruPrx22 (HRP_22684.1 / HRP_22684.2)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   349 (320)
PWM (Da):   %s   37694.21 (34812.8)  
PI (pH):   %s   6.73 (6.74) Peptide Signal:   %s   cut: 30 range:30-349
Sequence 390
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MGFSPSFSSSSIGVLILGCLLLQASNSNAKLRPDFYLKTCPSVFQIIGNVIVDELQSDPRIAASLLRLHFHDCFVRGCDASVLLDNSTSFQSEKDAAPNANSARGFDVVDRMKAALEKACPGTVSCADVLAISAQISVLLSGGPWWPVLLGRRDGVEAFFDLANTALPNPFAPLTELKEKFADVGLKRASDLVALSGAHTFGRAQCLLVTPRLYNFSGTNKPDPTLNPSYLVELRRLCPQNGNGTVLLNFDLVTPNAFDRQYYTNLRNGKGLIQSDQELFSTPGADTIPLVNLYSKNTFAFFGAFVDAIIRMGNIQPLTGTQGEIRQNCRVVNSRIRGMENDDGVVSSI

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGGGGTTTTCTCCTTCATTTTCTTCCAGTTCTATAGGAGTCCTAATATTGGGTTGCCTTCTGCTTCAAGCTTCAAACTCTAATGCTAAGTTGAGGCCTGACTTCTACTTAAAGACATGTC
CATCAGTTTTCCAAATCATTGGGAATGTCATCGTCGATGAACTGCAGAGTGATCCTCGTATTGCAGCTAGTCTCCTTCGCCTTCACTTCCATGACTGTTTTGTTCGT
GTAAGGACTTAAT
TACTCAACTTATCTTTTTATCCGAAAAAGAAAAAAACATGACGTGTTCAATGGACAAAATGACTTTTCAATACGGAAGTAGAGGCTAAAAGCAATTTTTAATTAATAAATACAATCTTCA
TGTATTATAATATGGTTTTGTAGGGTTGTGATGCATCGGTCCTGCTCGACAATTCCACATCATTTCAGTCCGAGAAAGATGCTGCTCCAAACGCAAATTCGGCTCGAGGGTTCGACGTCG
TAGATAGAATGAAAGCAGCCCTTGAGAAAGCTTGTCCTGGAACAGTGTCTTGTGCAGATGTTCTTGCCATCTCCGCTCAAATATCAGTGCTTTTG
GTATGTACATATACCTATATATGAC
TTATATCGGGTGAAACTAATCAAAATATATTATGAAATTTTGACGTTATGTTATATATTATATAGTCGGGAGGCCCATGGTGGCCGGTTTTGTTGGGGAGGAGAGACGGCGTAGAAGCTT
TCTTCGATTTGGCTAATACAGCTCTTCCCAATCCATTTGCCCCTCTTACTGAACTTAAAGAAAAATTTGCTGACGTTGGCCTAAAGCGCGCCTCAGATCTAGTTGCTCTTTCCG
GTAAAA
TTTTCATATTTTTCAATCTTTCTTGTTTTGGTCAACCATATTGTTTCAATCTATATAACCTACTCTATGTATTATTGTTTTTTTTATAATCTAACTAGATATAATTCATTTTATCTCGAT
AACTAGGTAGATATCGAGTTAGTCTGGAATTAACTTAGTAAAGTTATCTTCTAGGTAGATATCGAGTTAGTCTGGAATTAAGATCAAATTTGCAATGTCAACACAAGAAAAGTGACTTGA
AATTAAAGATGAGTTGGTCAAACGACATGACATGAGTCATCTTTAATAAAGTTAAACATATATACAATGTATCTAAACTTTACTTTTTTTTGTGGGGTCAAAATGGAAGGTGCTCACACA
TTTGGAAGAGCACAATGTCTACTTGTGACACCTCGTCTCTACAACTTCAGCGGCACCAATAAACCAGACCCAACTCTGAACCCATCTTACCTCGTCGAACTCCGTCGATTGTGCCCTCAA
AACGGAAACGGCACCGTTCTGCTCAACTTCGATCTCGTGACTCCAAATGCTTTCGATCGTCAATACTACACCAATCTTCGAAATGGGAAAGGTCTGATTCAGAGTGACCAAGAGCTCTTC
TCGACTCCAGGAGCCGACACGATCCCACTAGTAAACCTATACAGCAAGAACACGTTCGCGTTCTTCGGTGCATTCGTTGACGCAATAATTAGGATGGGAAATATTCAACCTTTGACTGGA
ACTCAAGGCGAGATAAGACAGAATTGTAGGGTTGTGAATTCGCGAATTAGGGGTATGGAGAACGATGATGGAGTTGTGAGTTCTATTTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGGGGTTTTCTCCTTCATTTTCTTCCAGTTCTATAGGAGTCCTAATATTGGGTTGCCTTCTGCTTCAAGCTTCAAACTCTAATGCTAAGTTGAGGCCTGACTTCTACTTAAAGACATGTC
CATCAGTTTTCCAAATCATTGGGAATGTCATCGTCGATGAACTGCAGAGTGATCCTCGTATTGCAGCTAGTCTCCTTCGCCTTCACTTCCATGACTGTTTTGTTCGT
GGTTGTGATGCAT
CGGTCCTGCTCGACAATTCCACATCATTTCAGTCCGAGAAAGATGCTGCTCCAAACGCAAATTCGGCTCGAGGGTTCGACGTCGTAGATAGAATGAAAGCAGCCCTTGAGAAAGCTTGTC
CTGGAACAGTGTCTTGTGCAGATGTTCTTGCCATCTCCGCTCAAATATCAGTGCTTTTG
TCGGGAGGCCCATGGTGGCCGGTTTTGTTGGGGAGGAGAGACGGCGTAGAAGCTTTCTTCG
ATTTGGCTAATACAGCTCTTCCCAATCCATTTGCCCCTCTTACTGAACTTAAAGAAAAATTTGCTGACGTTGGCCTAAAGCGCGCCTCAGATCTAGTTGCTCTTTCCG
GTGCTCACACAT
TTGGAAGAGCACAATGTCTACTTGTGACACCTCGTCTCTACAACTTCAGCGGCACCAATAAACCAGACCCAACTCTGAACCCATCTTACCTCGTCGAACTCCGTCGATTGTGCCCTCAAA
ACGGAAACGGCACCGTTCTGCTCAACTTCGATCTCGTGACTCCAAATGCTTTCGATCGTCAATACTACACCAATCTTCGAAATGGGAAAGGTCTGATTCAGAGTGACCAAGAGCTCTTCT
CGACTCCAGGAGCCGACACGATCCCACTAGTAAACCTATACAGCAAGAACACGTTCGCGTTCTTCGGTGCATTCGTTGACGCAATAATTAGGATGGGAAATATTCAACCTTTGACTGGAA
CTCAAGGCGAGATAAGACAGAATTGTAGGGTTGTGAATTCGCGAATTAGGGGTATGGAGAACGATGATGGAGTTGTGAGTTCTATTTGA

Retrieve as FASTA