Entry information : TaPrx26-1B(TraesCS2B03G0306700.1 / Prx113-B)
Entry ID 12927
Creation 2014-06-18 (Christophe Dunand)
Last sequence changes 2014-06-18 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2023-02-14 (Christophe Dunand)
Peroxidase information: TaPrx26-1B(TraesCS2B03G0306700.1 / Prx113-B)
Name TaPrx26-1B(TraesCS2B03G0306700.1 / Prx113-B)
Class Class III peroxidase    [Orthogroup: Prx180]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Triticum
Organism Triticum aestivum (bread wheat)    [TaxId: 4565 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value TaPrx26-1B
start..stop
S start..stop
AvePrx113-1F 644 0 1..316 1..316
TmPrx02 641 0 1..316 1..316
AvePrx113-1B 637 0 1..316 1..316
HvPrx11 609 0 3..316 2..315
Gene structure Fichier Exons


exon

Literature and cross-references TaPrx26-1B(TraesCS2B03G0306700.1 / Prx113-B)
Literature Simonetti,E., Veronico,P., Melillo,M.T., Delibes,A., Andres,M.F. and Lopez-Brana,I. Analysis of class III peroxidase genes expressed in roots of resistant and susceptible wheat lines infected by Heterodera avenae. Mol. Plant Microbe Interact. 22 (9), 1081-1092 (2009)
DNA ref. GenBank:   EU595577.1
Protein sequence: TaPrx26-1B(TraesCS2B03G0306700.1 / Prx113-B)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   316 (294)
PWM (Da):   %s   32797.1 (30826.1) Transmb domain:   %s   i7-29o
PI (pH):   %s   6.1 (6.10) Peptide Signal:   %s   cut: 23 range:23-316
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAASASCISLVVLVALATAAAGQLSPTFYDTSCPRALATIKSGVMAAVSSDPRMGASLLRLHFHDCFVQGCDASVLLSGMEQNAIPNAGSLRGFGVIDSIKTQIEAICNQTVSCADILTV
AARDSVVALGGPSWTVPLGRRDSIDANEAEANSDLPGFNSSRSELEAAFLRKGGLNTVDMVALSGAHTIGQAQCSTFRARIYGGDTNINAAYAASLRANCPQTVGSGDGSLANLDTTTPN
AFDNAYYTNLMSQRGLLHSDQVLFNNDTTDNTVRNFASNPAAFSNAFTTAMIKMGNIAPKTGTQGQIRLSCSRVNS

Retrieve as FASTA  
Remarks Complete sequence fom genomic (introns 1 and 2).
DNA
Send to BLAST
CDS
Send to BLAST