Entry information : Cbra1CysPrx01 ( g8949.t1 / CHBRA163g00330)
Entry ID 12955
Creation 2014-09-09 (Christophe Dunand)
Last sequence changes 2016-02-16 (Achraf Jemmat)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2016-02-16 (Christophe Dunand)
Peroxidase information: Cbra1CysPrx01 ( g8949.t1 / CHBRA163g00330)
Name (synonym) Cbra1CysPrx01 ( g8949.t1 / CHBRA163g00330)
Class 1-Cysteine peroxiredoxin    [Orthogroup: 1CysPrx001]
Taxonomy Eukaryota Viridiplantae Streptophyta Charophyceae Characeae Chara
Organism Chara braunii    [TaxId: 69332 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value Cbra1CysPrx01
start..stop
S start..stop
Mp1CysPrx02 304 3e-106 3..215 5..219
Mpal1CysPrx02 298 7e-104 3..215 5..219
Spra1CysPrx01 291 1e-101 1..216 1..218
Fe1CysPrx 286 3e-99 3..215 4..219
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1473986..1474393 408 N° 2 1476530..1476772 243  
join(1473986..1474393,1476530..1476772)


exon

Literature and cross-references Cbra1CysPrx01 ( g8949.t1 / CHBRA163g00330)
Protein sequence: Cbra1CysPrx01 ( g8949.t1 / CHBRA163g00330)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   216
PWM (Da):   %s   24095.3  
PI (pH):   %s   6.61
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MVVSLGDVIPDREVVTTHGKLKLHEYVGDGWLMLFSHPGDFTPVCTTELGKIAHMHREFEKRGVKLMGLSTDDVKQHEEWAKDVEAFGGSPVKYPIIADPDRTVGQELNMMDPDLKDDKGHPLASRALHIIGPDKRIRLSFLYPGKVGRNMDEVLRVIDALQLAENHRIATPVNWRPGDPVVISPSVSEEEAKQFPGYMVKTLPSGKMYMRMTSIS*

Retrieve as FASTA  
Remarks Complete sequence from RNA seq and genomic (scaffold_163, 2 introns)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGTTGTCAGTTTGGGAGATGTGATTCCGGACCGGGAGGTGGTTACCACCCATGGCAAATTGAAGTTGCACGAGTACGTGGGCGATGGCTGGCTTATGTTGTTCTCCCATCCAGGGGAT
TTCACACCGGTATGCACGACGGAGCTGGGGAAGATAGCCCATATGCATCGCGAGTTTGAGAAGCGCGGGGTGAAGCTGATGGGCCTGTCCACTGACGACGTGAAGCAGCATGAAGAGTGG
GCCAAGGATGTTGAGGCCTTCGGCGGAAGTCCCGTTAAGTACCCCATCATTGCGGATCCCGACCGCACTGTGGGACAGGAACTTAACATGATGGATCCTGACCTGAAGGACGATAAGGGT
CACCCCCTAGCCTCTAGAGCGCTTCACATCATTGGCCCTGACAAACGC
GTAAGTGTCATCATCGTCTCTGATCACCATCGTCATCCTCGTCATTGCTATTGTTTATCTACCTAATTCTCA
TCATCGTCATTCTATTTGCATCCCTGGTCATCTCTAATCTGTCCTCGTCGGCAGCTCCGTCATCGAAGAAGTACCCGTGAGCGGGTGGTGGGCCTTCTTCCTCTTGTTGTTTTTGTGAAT
CAATCCGAATGAATGGGGGAGTGTAATTCTCGGTGCAGCCACCCGCAGGAACTCACAAGGCCGACCCGCAGGAAGGGAATGAGGCCCTTGGTCCTCGTCTGTGAACCATCGCGCGATTGC
TGTATGTTCAATGGGTTTGACAGTGTGTAATCGTGGCGAATCCTTTCCTGTGCCTCACGGCATCTTCGCAGCATGCGGAGTTTTTCTGGATTGAATTTGGCTGGGAGAGTAACTACTGTG
CCAGCCAATTTCTTTAGAGCTCTCTTCAATCTTCAGTAGTGTATAGTAGGTTAAGTACTGCAGTGTTAGTACATTTCTTTGTGTAAATACCTTCAGGAGTGTACTGCAGGTTAATTACTG
TGTCTTTGCGTATTAAATACCTTCAGGAGTGTACTGCAGCAGGTTAACTACCGTGTTCGATTTCTTTGCGAAACTATCTCCAAATCGTGTCCTGTGAAGTTTAAACTCTGTGTGCTTGAC
CGTCGCTACTTGTTTTTTTTTTGTGTGTTCCTATTTGTAATGGGTTTGCGGATTGGGAAGAGTCGTAAAACGAGTCAGAAAACCTCCCCGCGACAATACCTTTGAATCCCATTTCTCCAC
AAACAAGAAAAGAAGTGCCGCAGGTCCCCCCAATATCACTTTTGGTGTCATTTCTGCACCCTGGCTAGGCCGGTAACGGTCGCTGTGTAAAAATGGCGGGAGAGTGTTTTGCGGGGTGCA
AAAATGACGCCGACGCCGAAAGTGATTTTGGGGTCCGAACATCACTTTTGGTGTCATTTCTGCACCCTGGCCGCAGCTGTGTAAAAATGGCGGAAGAGTGTTTTGCAGGGTGCAAAAAGG
ACGCCGAAAGTGGAAGTGATTTTGGGGCCTGCGGCACCTTTTTCCGCGTTTGGGGGAAAGTGGAAGCAAAGGTATTGTGACTTTTCCCTTCGCAGATTCTGTTGTGAGCTCGTACTTTGG
ATTTGTCCTTTGTTTCTTGTGTTTTTCTTCGGGATAACGTCTGAAATTTGTCTGTCAGCCTTTAGAAAAATCGTGCGTGTCTCAGAAAAGGTGAGGGCGTACACTGAGATTACAGAAAAC
TGAAACCCGCTCATTTTCTTTTGTTTTGAATCTGAAACTGAAACCCGCTCATCTTCTTTTGTTTTGAATCTGTTTTATCTATGCTGTTTTGCAATGTTTCATGTGTAGATTGGCTGGGCT
TACGGTTCGCAAATGTAACTCGTGGATTTTCTTCCACAAACGTTTTGTTTGGGACGCTGGGCCTATGGTTCGCAAACGTACCTCACCTTTTTTTTTTTTTTTGGTGGTACGACTTCACCA
ATTTGCGCTACTTCACTTCACCGATTTGGCTTCACAGATTGACCTACCTTGTGCTTTGCATGTGCGTATTACTTGTGAGACTCTTGTGAGACTCTGTTCGCGTTTGCAGATTGGATCCGA
CAGGAGTTTTCATAGAAGAGATGTAGCTTGTGCTTCGCATGTTTGACTGGTGAGACTTGTACGCGTGTGTTTACAGAGTGGATCCGACACGGACCGACAGGAGTTTTCGTAGAATAGATG
TAGCTTGTGCTTCGCTTGTATGTACTTGTGAGACTTGTACGCGGTTGCAGATTGAATCTGACAGGAGTTTTCATGGAAGAGATGTAGCGGGTTCATGGAAGAGATGTAGCTTGTGCTTCG
CATTATTGTACTTGTGAGACTTGTACGCGTTTGCAGATTGGATTCGATCGCATGTGTTCTCACTTGTGACACTCGTACGCGTTTGGAGATTGGATTCGAACAAGACGTTTTGTGTATCAA
AAAAAAAAAAAAAAAAAAAAACTTTTTGTGTATTCTGTGCGCGTGGTTCACGTACGTGCTTCACAGATATGACTGACTTTGGGCGTGTATGTTTTTCGTTGTGTGTGTTGGGGGGGGTGG
GGGGGGTTTGTACTGTGTGCACAGATCCGACTCAGTTTCCTGTACCCTGGTAAGGTGGGCCGTAACATGGACGAAGTCCTCCGTGTCATCGACGCTCTGCAGCTGGCCGAGAACCATCGG
ATCGCGACGCCGGTCAACTGGAGGCCTGGAGATCCCGTCGTCATCTCTCCGTCGGTATCTGAGGAAGAAGCAAAGCAGTTTCCTGGCTACATGGTCAAGACTCTTCCGTCTGGGAAGATG
TACATGCGCATGACGTCCATTAGCTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGTTGTCAGTTTGGGAGATGTGATTCCGGACCGGGAGGTGGTTACCACCCATGGCAAATTGAAGTTGCACGAGTACGTGGGCGATGGCTGGCTTATGTTGTTCTCCCATCCAGGGGAT
TTCACACCGGTATGCACGACGGAGCTGGGGAAGATAGCCCATATGCATCGCGAGTTTGAGAAGCGCGGGGTGAAGCTGATGGGCCTGTCCACTGACGACGTGAAGCAGCATGAAGAGTGG
GCCAAGGATGTTGAGGCCTTCGGCGGAAGTCCCGTTAAGTACCCCATCATTGCGGATCCCGACCGCACTGTGGGACAGGAACTTAACATGATGGATCCTGACCTGAAGGACGATAAGGGT
CACCCCCTAGCCTCTAGAGCGCTTCACATCATTGGCCCTGACAAACGC
ATCCGACTCAGTTTCCTGTACCCTGGTAAGGTGGGCCGTAACATGGACGAAGTCCTCCGTGTCATCGACGCT
CTGCAGCTGGCCGAGAACCATCGGATCGCGACGCCGGTCAACTGGAGGCCTGGAGATCCCGTCGTCATCTCTCCGTCGGTATCTGAGGAAGAAGCAAAGCAGTTTCCTGGCTACATGGTC
AAGACTCTTCCGTCTGGGAAGATGTACATGCGCATGACGTCCATTAGCTAA

Retrieve as FASTA