Entry information : SpolPrx05 (Spipo1G0078800 [2.0])
Entry ID 13192
Creation 2015-05-28 (Christophe Dunand)
Last sequence changes 2015-05-28 (Christophe Dunand)
Sequence status complete
Reviewer Catherine Mathe
Last annotation changes 2016-02-26 (Catherine Mathe)
Peroxidase information: SpolPrx05 (Spipo1G0078800 [2.0])
Name (synonym) SpolPrx05 (Spipo1G0078800 [2.0])
Class Class III peroxidase    [Orthogroup: Prx021]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Araceae Spirodela
Organism Spirodela polyrhiza (great duckweed)    [TaxId: 29656 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SpolPrx05
start..stop
S start..stop
SpolPrx41 581 0 1..325 1..325
LminPrx19 457 2.08e-163 1..325 1..324
LminPrx46 456 9.43e-163 1..325 1..324
LminPrx17 454 4.71e-162 1..325 1..324
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '13192' 'join(4888896..4889108,4889250..4889438,4889537..4889702,4889834..4890243)' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 4888896..4889108 211 N° 2 4889250..4889438 187 N° 3 4889537..4889702 164 N° 4 4889834..4890243 408
join(4888896..4889108,4889250..4889438,4889537..4889702,4889834..4890243)


exon

Literature and cross-references SpolPrx05 (Spipo1G0078800 [2.0])
DNA ref. Phytozome 12:   pseudo1 (4888896..4890243)
Cluster/Prediction ref. Phytozome Gene 12:   31521296
Protein sequence: SpolPrx05 (Spipo1G0078800 [2.0])
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   325 (301)
PWM (Da):   %s   35372 (32563.5)  
PI (pH):   %s   7.31 (7.70) Peptide Signal:   %s   cut: 25 range:25-325
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MGFRETGALLLTLILGFWVTQFEAQLQVGFYLSSCPDAEKIVREEVVKALVTHPDLPADLLRLHFHDCFVRGCDGSVLLDSTPGSTAEKDSPINNSLEGYDVVDNAKTRLEAICPGIVSC
ADIVAFAARDSVKLSKGIPYDVPAGRRDGTVSLSSETFTNLPSPTFNLDQLTKNFASKGLTQKDMVILSGAHTIGEARCSSITSRLYNFNSTGRVDPSLDPAYAARLKKKCPPNSVNSNQ
GVDMDPPSPTIIDSSYYRNLLVNRGLFTSDQTLMSSPVTASLVLRNAFNDFLFRRNFAVAMVKMGRVEVLTGANGEIRKKCNVIN*

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns).
Promoter
Send to BLAST
Send to cis Analysis
.........1 .........2 .........3 .........4 .........5 .........6 .........7 .........8 .........9 .........0 .........1 .........2
GGAGGAGACC CACAATCACT GCTAGTGCTG TCACCACCGG AGGTGGGAGG GAGAGGTGAG CCAGCCCACC TATGGTGTGC TATAGGTGGT GCCAAGGGAG AGAGGAGTAG GCCATCCCCA  CAGTAGGAGA GGGACTCACC AAGGGAGGAA GGAGAGAGAG AAGGGCTGAT CATGAATGAG GAGAGGGCTA GTGGTGGCTC CCCTCTTTTC GGCTTGTTTG CCCTACCTTA GACCTTTCAG  TTTTACCCCT GCATCTTGCA ACATTTACAA GTAAGTCTTT TATACAATTT TACCTTTTTT GTTCACATAT TACATAAATG CCCTTAATTG TATTATGTGC ATAGTATCAT AGTTACAAAT  TAATTTTCCC CTTTGTCATT TGCTTTGATG CTCACATTTT TGTAGAAAAT AGGAAAATGA TATAATTCAT AAAATAAAGT GTGAAAATAT GTAAGTAAAG TATTTAATAT ATAATTATCA  TATTCTTATA TTCTTTACGC TTTAATCATT AATCATATTA CCCTTTTAAT ATGATAATTC AAGGAGTTAT CACCTGGTCT TTACAACCAA CTCAACTAGA GCCATAGGGT CTTGTTATCA  TTTCCATGGA GGAGTGAAGA ACACAAGTCT CTACTTTTTC AAAATCAATT ACTTGAGTCT CTCAAGGGTG AAGTAAGAAC CTTATATCGG CCCAAATTAG ATTAGGCTGA GCTCAATTCA  TCTGCCTTGC CCATTACAAC TAAAATGGGC TTGAGTCCTA CATCACTCCC TCTTCCACTC TCCATCCTCT CACTATCCCG CTCTCTTTCC TCTCTCCCTC TCTCACTATT TCTTGCTCTC  TTACATGTTA ACCGAAAACA AAATTAATTT TTATCAAAAT TGAAAATATC CTAAAAATAA AATGAAATTT GTATTCATAA TTTTTATTTT ATTCTCATAA TTATGTGATT AAAGAATTAT  TACTTCCTTG CTCAGAGCCA CTATTCACTA GTGGGCCAAC TGTAAGCTTC CTAGTTTAAG TATGGCCTTC AAATTCAGTT ATGAATTAGC AGATACTGAC GAAGGTAAGA TAAAATGGCA  GATCATGTGA ACCCGGATTA TAAGAAAACA ATTCCAATCG TCCAAACAGT TAAGGATGCA TCTACTTAAA GCCAAGGAAG AAAGCACGGC CAGCGCCGAC AGATGGGCAG TCACCCGCTC  AAATATGCAT TTCCCAATCG TCTTGAAAAG ACAATTGGGC CCACACGCTC TCAGCATGTG AGTGGCGGAT ATTAGGGGAG AATGTACACG TCATGGTTCG CCTGGAGTTT ACGATATAAG  ACGAAATGAA TTTCTTCCAC CAGGAAGACG CAAGATTATT TCGTGTGGGG TAGGCGATTT GGCCTCTGTC AAACGAACCA TACGAAATAA CAAGAACTGT AAGGAGAAAG ATAAAGCCAC  ACACTTGTGC CACTTGATGA GTCGGTGTTT AACGTGCCGA CATCTGCGGA TCGTTGACAT TTAGTCGATC GCTTTCCTAT TTGAAACTTT CCACGCGGCC GAGATCCCTT CTCGACAAAC  TCAAACTCTC CTACCACAGG CCAGTCAGTC TTCAACGGAT GATTTCGCAA TGCAGTGGCC TCTATTGGTT AAGCCCATAC ATGGCGACGT TGCAGCGCCT TTCCGGGGCG GCCCCATCTT  CATGGTAACG GCTGCCCATT TGAATTAAAA TATAGGAAGA CGCCACACAA AACCTCACCC CCCTCCCTTT CACCGACATC CTTCCCTCTG AAACGCCAGT AGCGTACAGC TAATGGCTCT  TACTTTACAA GGTGGTGGAT GAGTTGTGTT CGAAGCGGTG TTAAATAAGG AGGAAAAACG TGGGAATCAG GGGAATAGGA CGCCTTTAAA ATGGAGGGAT CCACTCCCTG TAGTGCGCAA  CCAAAGCTTT GAGAACTCTG CGAATTTCAA GTCGCGTGGT AGGCGTGTGG TGAGGCTCAT TCTCTGTCCA GAAAGGAAAA ATGGGTTTCA GGGAAACTGG GGCTCTGTTA CTGACACTTA  TACTGGGCTT CTGGGTGACC CAGTTTGAAG CTCAGCTTCA AGTAGGGTTC TATCTTAGTT CCTGCCCTGA CGCGGAGAAA ATCGTTAGAG AGGAGGTGGT TAAGGCACTA GTAACGCATC  CGGATCTGCC TGCTGATCTA TTGAGGTTGC ATTTCCACGA CTGCTTTGTC AGGGTAACTT TTCCACTTCT AACTCCACAC AAAGCTTATT ATTAACGATG GAGCCTGCAA GAGACGAGTG  ATCGTATCAT TATAGAACGT TTAATAGTTC ATTTTCTGAG TTTGACGTTC TCTGGGGACC TCGCTCTGTC ATAGGGCTGC GATGGGTCGG TCCTCCTCGA TTCAACTCCA GGTAGCACCG  CGGAGAAGGA TTCCCCAATC AACAACAGCC TTGAAGGCTA CGATGTCGTT GATAACGCTA AAACCAGACT GGAGGCGATT TGCCCCGGCA TTGTCTCGTG TGCCGACATT GTTGCATTCG  CTGCCAGAGA CAGCGTCAAA CTGGTAACCT TTTTTGAGCA AACGATTCAT GAACCGTTCA CTCACTGCTC TGCTTATCCT TTAACTTTTT GAGGTAATCA TACATTCGCA ATCTTGGGCA  GAGCAAGGGC ATTCCCTACG ATGTTCCAGC CGGAAGAAGG GACGGCACGG TTTCCTTGAG CTCGGAGACA TTCACGAATT TGCCTTCACC CACCTTCAAC CTCGACCAGC TCACTAAGAA  TTTCGCCAGC AAGGGCCTTA CCCAAAAGGA CATGGTCATA CTCTCCGGTG CGTTTTGGAT TCAGAGCATG CTGCGGAAGC TTATCCGCTT CCAACTCAAT TATCTCTTCC AGAACTAAAT  TTTGTCGATA ACTTGCCTGA TTTTCATCCT CACTAAGACC TCTACTTTAC ATAATCAGGT GCGCATACCA TCGGCGAAGC CCGCTGCTCC TCCATCACTA GTAGGCTTTA CAACTTTAAC  TCCACCGGAA GGGTTGATCC GAGCTTGGAT CCAGCCTATG CGGCCAGACT GAAGAAAAAG TGCCCGCCAA ACAGCGTTAA CAGCAACCAG GGAGTGGATA TGGACCCTCC CAGCCCCACT  ATTATCGACT CGAGCTATTA CAGGAACCTC CTCGTTAACC GGGGGTTATT CACGTCCGAT CAGACCCTCA TGTCTAGCCC GGTGACGGCA TCACTGGTGT TGAGGAACGC CTTTAATGAC 
TTTCTCTTCA GGAGGAACTT CGCGGTCGCT ATGGTGAAGA TGGGTCGGGT TGAGGTCCTC ACCGGAGCCA ACGGGGAGAT CCGCAAGAAA TGCAACGTCA TTAACTGA 

Retrieve as FASTA  
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGTTTCAGGGAAACTGGGGCTCTGTTACTGACACTTATACTGGGCTTCTGGGTGACCCAGTTTGAAGCTCAGCTTCAAGTAGGGTTCTATCTTAGTTCCTGCCCTGACGCGGAGAAA
ATCGTTAGAGAGGAGGTGGTTAAGGCACTAGTAACGCATCCGGATCTGCCTGCTGATCTATTGAGGTTGCATTTCCACGACTGCTTTGTCAGG
GGGTAACTTTTCCACTTCTAACTCCAC
ACAAAGCTTATTATTAACGATGGAGCCTGCAAGAGACGAGTGATCGTATCATTATAGAACGTTTAATAGTTCATTTTCTGAGTTTGACGTTCTCTGGGGACCTCGCTCTGTCATAGGGCT
GCGATGGGTCGGTCCTCCTCGATTCAACTCCAGGTAGCACCGCGGAGAAGGATTCCCCAATCAACAACAGCCTTGAAGGCTACGATGTCGTTGATAACGCTAAAACCAGACTGGAGGCGA
TTTGCCCCGGCATTGTCTCGTGTGCCGACATTGTTGCATTCGCTGCCAGAGACAGCGTCAAACTG
TGGTAACCTTTTTTGAGCAAACGATTCATGAACCGTTCACTCACTGCTCTGCTTA
TCCTTTAACTTTTTGAGGTAATCATACATTCGCAATCTTGGGCAGAGCAAGGGCATTCCCTACGATGTTCCAGCCGGAAGAAGGGACGGCACGGTTTCCTTGAGCTCGGAGACATTCACG
AATTTGCCTTCACCCACCTTCAACCTCGACCAGCTCACTAAGAATTTCGCCAGCAAGGGCCTTACCCAAAAGGACATGGTCATACTCTCCG
CGGTGCGTTTTGGATTCAGAGCATGCTGC
GGAAGCTTATCCGCTTCCAACTCAATTATCTCTTCCAGAACTAAATTTTGTCGATAACTTGCCTGATTTTCATCCTCACTAAGACCTCTACTTTACATAATCAGGTGCGCATACCATCGG
CGAAGCCCGCTGCTCCTCCATCACTAGTAGGCTTTACAACTTTAACTCCACCGGAAGGGTTGATCCGAGCTTGGATCCAGCCTATGCGGCCAGACTGAAGAAAAAGTGCCCGCCAAACAG
CGTTAACAGCAACCAGGGAGTGGATATGGACCCTCCCAGCCCCACTATTATCGACTCGAGCTATTACAGGAACCTCCTCGTTAACCGGGGGTTATTCACGTCCGATCAGACCCTCATGTC
TAGCCCGGTGACGGCATCACTGGTGTTGAGGAACGCCTTTAATGACTTTCTCTTCAGGAGGAACTTCGCGGTCGCTATGGTGAAGATGGGTCGGGTTGAGGTCCTCACCGGAGCCAACGG
GGAGATCCGCAAGAAATGCAACGTCATTAACTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGTTTCAGGGAAACTGGGGCTCTGTTACTGACACTTATACTGGGCTTCTGGGTGACCCAGTTTGAAGCTCAGCTTCAAGTAGGGTTCTATCTTAGTTCCTGCCCTGACGCGGAGAAA
ATCGTTAGAGAGGAGGTGGTTAAGGCACTAGTAACGCATCCGGATCTGCCTGCTGATCTATTGAGGTTGCATTTCCACGACTGCTTTGTCAGG
GGCTGCGATGGGTCGGTCCTCCTCGAT
TCAACTCCAGGTAGCACCGCGGAGAAGGATTCCCCAATCAACAACAGCCTTGAAGGCTACGATGTCGTTGATAACGCTAAAACCAGACTGGAGGCGATTTGCCCCGGCATTGTCTCGTGT
GCCGACATTGTTGCATTCGCTGCCAGAGACAGCGTCAAACTG
AGCAAGGGCATTCCCTACGATGTTCCAGCCGGAAGAAGGGACGGCACGGTTTCCTTGAGCTCGGAGACATTCACGAAT
TTGCCTTCACCCACCTTCAACCTCGACCAGCTCACTAAGAATTTCGCCAGCAAGGGCCTTACCCAAAAGGACATGGTCATACTCTCCG
GTGCGCATACCATCGGCGAAGCCCGCTGCTCC
TCCATCACTAGTAGGCTTTACAACTTTAACTCCACCGGAAGGGTTGATCCGAGCTTGGATCCAGCCTATGCGGCCAGACTGAAGAAAAAGTGCCCGCCAAACAGCGTTAACAGCAACCAG
GGAGTGGATATGGACCCTCCCAGCCCCACTATTATCGACTCGAGCTATTACAGGAACCTCCTCGTTAACCGGGGGTTATTCACGTCCGATCAGACCCTCATGTCTAGCCCGGTGACGGCA
TCACTGGTGTTGAGGAACGCCTTTAATGACTTTCTCTTCAGGAGGAACTTCGCGGTCGCTATGGTGAAGATGGGTCGGGTTGAGGTCCTCACCGGAGCCAACGGGGAGATCCGCAAGAAA
TGCAACGTCATTAACTGA

Retrieve as FASTA