Entry information : SpolAPx02 (Spipo0G0091000)
Entry ID 13207
Creation 2015-06-09 (Christophe Dunand)
Last sequence changes 2015-06-17 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2015-06-17 (Christophe Dunand)
Peroxidase information: SpolAPx02 (Spipo0G0091000)
Name (synonym) SpolAPx02 (Spipo0G0091000)
Class Ascorbate peroxidase    [Orthogroup: APx2002]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Araceae Spirodela
Organism Spirodela polyrhiza (great duckweed)    [TaxId: 29656 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SpolAPx02
start..stop
S start..stop
PnodAPx06 647 0 85..435 83..433
PnodAPx03 643 0 63..435 64..436
VvAPx06 640 0 59..435 42..424
GmAPx07 640 0 22..435 19..432
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '13207' 'join(6722382..6722600,6722722..6722859,6723382..6723502,6723572..6723672,6723751..6723838,6724084..6724151,6724250..6724336,6724561..6724635,6724725..6724802,6724934..6725038,6725147..6725221,6725366..6725518)' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 6722382..6722600 217 N° 2 6722722..6722859 136 N° 3 6723382..6723502 119 N° 4 6723572..6723672 99
N° 5 6723751..6723838 86 N° 6 6724084..6724151 66 N° 7 6724250..6724336 85 N° 8 6724561..6724635 73
N° 9 6724725..6724802 76 N° 10 6724934..6725038 103 N° 11 6725147..6725221 73 N° 12 6725366..6725518 151
join(6722382..6722600,6722722..6722859,6723382..6723502,6723572..6723672,6723751 ..6723838,6724084..6724151,6724250..6724336,6724561..6724635,6724725..6724802,67 24934..6725038,6725147..6725221,6725366..6725518)


exon

Literature and cross-references SpolAPx02 (Spipo0G0091000)
Protein sequence: SpolAPx02 (Spipo0G0091000)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   435
PWM (Da):   %s   46729.93 Transmb domain:   %s   o415-434i
PI (pH):   %s   8.67
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAAILPSPASISGLGASLAGPSAAAAGGAVSSRRAVTLSSLLLSPRCSALPSSSRRISLKGSPFSPLRLHSQKNARGGAVRKSSGAASATSFASDPGQLKSAREDIKELLRTKFCHPIMI
RLGWHDSGTYDKNIEEWPKRGGADGSLRFEPELRHGANA
GLINALNLLQPIKDKYPGVTYADLFQLASATAIEAGGPKIPMKYGRVDVTDPEQCPEEGKLPDAGPPSPASHLRQVFYRMG
LGD
EIVALSGAHTLGRSRPERSGWGKPETKYTKDGPGAPGGQSWTVQWLKFDNSYFKDIKEKKDEDLLVLPTDAALFDDPSFKVYAEKYAEDQEAFFKDYAEAHAKLSDLGAKFDPPEGF
SIDDDPKEAKPEKFVAAKYSSGN
RELSNSMKQKIRAEYEAIGGSPDKPLQSNYFLNIMIFIAGLALLTSLLGN*

Retrieve as FASTA  
Remarks Complete sequence from genomic (11 introns). Incorrect prediction from Phytozome (missing first exon, extra exon).
Promoter
Send to BLAST
Send to cis Analysis
.........1 .........2 .........3 .........4 .........5 .........6 .........7 .........8 .........9 .........0 .........1 .........2
GCATCATCGT ATGTCTGTGC TGGCGATGCA TCATCAGGAC CTTGTCCGGT ACCGACGTTT CCCTTCGGAG GAGCTTCTTC ATGAAAATCT GCTGTCTGAT CGTCACCCAT TTTTTGGTCC  GTAGAAGTCT CGGAACTTCT CTCACCCCAA GAATCGTTAT TATTGGTGGC ACCTTCAGCT TTCGTTTCAC CTTCTGGCAC AACGCCAGAA CTATCCTCGA ATGGCATATC GGTCTGAACT  TGGCTTTTAG CATCAGATTT GGTCTCAGAA ATAGATATAT CGACTGGAAC CACTGCTGAC GATGTCATCA TCCAGATCCC AACCAGGCAA AGACCAACAA ACAAAACGAG GGTCGCTGTT  GAACAGTAGG AGGAAGAAGA AGGCCTCCTA CCCTCCGTAC GGGGGTTTCT TCCTAGCGCC ATCTTTCTGT ATTCAGTGTC CCCCCAAAAC AGTACAGACA GCTGCAAAAG AGGAATTGGA  AATAACATAT GCATTCAATA AATCCGTTCT ACAAGATAAA CGAGATCCCC GTGCAAAAAC AGGAGAGAGA ATTTTTTTAT AGAAAAATGT CGAGCTGCAA TCATCAAGGA ATCACAAGCT  GGAGGTCGAA ACTGAGAAAG TCAATTACTC TCCAAATTTC TCCAGACAGA CGGTACAAAA TAAAGGAAAA TGCACGATAA AAATAGGAAA ATAGAAAGGC AAGACAAACC TAAAAACTTC  AGAGACGTGA GAGGGAGAAA CACACTGCAC AACCGATCAC ACCGGCATCA TGTCACACCT CAACGCGGCT GTCACAACAA AAGCACGAAA TACGGCACAG ATATACACAA TGCAGCTCAG  CAAGCGACAC CATTTGCTCC CAAAAACGCG TCATAAGGCA AATATATGGA CAATGCAGCT CCGGAGGCGA CACCATATGC TTCCAAAAGC ACCATGTCAG GGATGGACCG CCACAGAAGA  TCAGGAAACA AACTTCAATA AGCCTCAATC AGTCACCGGA TGAGATACGA CAATGGCGCG ACACAGCGCC ACAATGCAGC GCCACAACGA GAAAAACCAC CCGACATTAA ACGAAAGCGC  GTAACAAGGC AAAGACATAC GCAATGCAGC TCAGCAAGCG ACACCATCTG CTCCCGAAAG CACCGTACCA GGGACGGACC GGGACAGAAG ATCACGAATC AAACCTCAAC ACCCCTCGAT  CAGTCACCGG ATGAGACACA GCAATGGCGA CGAGAAAAAC CACCAAACAT TCAGACCTAA AGCAGATTCC CCCCCGTACC TTGCTTCAGC TTCAAGCTCC CCGCCGCGCG AGCTCCCTCC  TCCTCCTACC GCCACCACCC GAGATGAGAT CGACGAGATG ATCCAAGATC GAGGAATCGC GAATCCGAGG ATCGCAATTC CACCTCTTTA TTGCAGGAAC AGGCGCCACC TCGCCGCCCC  TCCGACGGTG GCAATCACTC CGCCGGCCGC GATTTCCTGA GAGCGGAGGA GGAGAGCCTG TAATGGCTGT TCATCCACAA GAGCCCCCGC TTTTGTAGGC CATCTTCCCC TGTCCCTCGC  CCACACCCTA ATCAGCACCC ACGGAGGCTT CGCCACGTAA GAGACCCCCG GGTTATCTTT GTTTTTATTC ATGGTCGTAC GGTAGGGTAA ACAGTTCCTA AGGAACACCA ATTTGCGTCC  TCGCGGGGAG CAGAGCTCAC GATACGGACG GACCGGGGTC TCCGCGGGCT GTCCGAGCCG GCCCCACGGA AAGATTCGGC CCAGCCCGAA AACGTAGGGC CCGGCCACGT GTGCTGACAG  AGCAACAAAA GATCGTGGTC CACGTCAGAC AGAAAAGCCC GCCCGATAGA GCGACATGTC AACGGTTATC TGATACGTGT CTATTTGCTA TTCGTTTATC AAGGATTGGT CTCACGGCGA 
GGAACAATAG CCGTTGACGG CGCTTTTTAA GGCCCAGGAC AGAGAGCGCG ATCTTATGAG CAGGAGTCTC AGATCGAACC 

Retrieve as FASTA  
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGGCGATTCTGCCCTCACCGGCCTCCATCTCCGGCCTCGGGGCCTCCCTGGCCGGGCCCTCCGCCGCCGCAGCCGGCGGCGCCGTTTCGTCGAGGAGGGCGGTGACGTTGTCGTCC
CTTCTTCTGTCGCCGCGATGCTCCGCCCTCCCCTCTTCCTCTCGCCGCATCTCACTCAAGGGATCTCCATTTTCCCCTCTCCGCCTCCACTCCCAGAAG
AGGTAATTTCGCTCGCTTTTC
ATTGCTTTGATGCGACTGATTACGGGCTGTGTGCGTGGTGGATGGGAAGTTTCCTCGATTGCCTGCGAAATTTTGAGCTCAGATGGGGTTTTCCGTTCGTAGAATGCGCGCGGCGGGGCG
GTGCGCAAGTCGTCGGGGGCCGCCTCCGCCACGTCCTTCGCGTCGGATCCTGGCCAGTTGAAGAGCGCGAGAGAGGACATCAAGGAGCTCCTCAGGACGAAATTCTGCCATCCCATCATG
TGGTAGCCCCCCTCAAATCCGTGCACCTCCAAAGACGGCTTCGTCTAGGGTTTCCCCTCTCCGTTTTTTCACCGAGTTGTGTATTTCAATCGTTTGCTTGGTCGTGATAGATTTCAAATG
TTTTCTCCTCTTTGACTTATCGCGATGGACCAACGATTCTTCCAAATGTTAGTGCGAATATTATGAATTTGAATGAAACCCTATTTAATGGCTAACCACGAAGAGAAATCTGGACAAGAC
GTAGAAAAACAGTGAAACAATGTTTCTTGATCTTATGCGGGAAGAACATCGTCTGAGCGTGTTGTCTGCGGCTATTATACTGCATTCGGTAGTTTTCCTCGGCAAAATTATGATCCGGTT
TATACATGAACGGAGCATACGGTCCTTCATGCTGGTTCTTCGTATGATATTTTCTTTGATAGTTCGAACGAAATTTAGATCGTAGACAATTTTCCATTAGAATACACTGCAGGTGATTTG
ATTGTTTTCGATTGAGTAACTCTGGCTCTTCATCTTCGCATTAGATTCGGCTTGGATGGCACGATTCTGGAACCTACGACAAGAACATTGAAGAGTGGCCCAAAAGAGGCGGAGCAGATG
GAAGCCTGAGATTCGAGCCAGAGCTGAGGCATGGAGCTAACGCCG
CGGTACCTTTCCTGCCCCAATCCCACTCCAACCTGCCGACTAAGTTTCCATGTACTGACGAGGTGCCGCAGGTCT
CATAAACGCCTTAAATCTTCTTCAGCCTATCAAGGATAAGTACCCTGGAGTTACATACGCAGACCTGTTCCAATTAGCCAGCGCCACAGCGATCGAG
AGGTTCTTGTTCAATCATATTTA
CTTTATCTACGAATTGGCGCAGAAGACATTGATAACTGATGTGAAATTAGATTTTAGGAAGCCGGCGGCCCGAAAATCCCCATGAAATATGGTCGCGTGGATGTCACTGACCCCGAGCAG
TGCCCTGAAGAGGGGAAGCTTCCTG
TGGTGAGAAATATCATACGCCTCTGCAACAAGTATTTTAGGATCTCCTTCCATGTTATTTCTCTGAATTCTTGACCCTCATCTCAACTGGAAACA
TTGCTCCATCCCTTTATTTTTTATTTTAAAAATTATTTTTTTGGGTACGATCTTCTTTGTCACCATATAATTGTGATCTCAGTTTCGGACTTTCAGAGAATTCCTTGCGTAATTCCCTGC
ATTAAGGGTTTATAGTCTTCTGAATTTCGTAGATGCTGGCCCACCTTCTCCAGCCTCCCATTTACGGCAAGTGTTCTACAGGATGGGCCTCGGTGACAAGAGGTCAGCACCCGCAGCACA
GTCCATATTTATTCATCACACGGACGTCTGATTCTTCATGACGAGCTTATAATTTCGGGGTCACCTGTCGGTCCTTGCAGGAAATAGTCGCATTGTCCGGTGCCCATACTCTGGGAAGAT
CAAGACCCGAACGCAGTGGGTGGGGCAAGCCAGAGACCAAGTATACA
CAGTAAGGATAAATCCCATCTCCAAGATTTGTTTCCATTCTTATTTTTATTTCTATTTTTATTTTATTTCGTG
GCGTTGATCTCCTCATCCAATAGCATAAATAAAAACACTGTGGATTGCTGGTGTGCGTTGACCGTCCCCCTCTTCATTTCTCTTCCATTGAAGCCCCCCCCCTCATCCTTCATCTGGTGT
AGTTATGCGGTCAAACTCTGTGATTCTTGACAGAAAGATGGGCCGGGCGCCCCCGGAGGTCAATCGTGGACTGTGCAGTGGTTGAAGTTTGACAACAGCTACTTCAAGAGGTGGGGAATC
TTTTTATCTGGCCTCTGAATGATTTATTTATTTATGTATTATTATTATTATTATTTTTTCTTCCAAACTTGTCATTCAGGATATCAAAGAGAAGAAGGACGAAGATCTGCTGGTGCTGCC
CACCGACGCTGCTCTATTTGACGACCCATCCTTCAAG
AGGTAACCGAGATTCTTGGACTGCATATAGATTAAGAAAAATAAAAAAACTCATAAAAAGATAAAGAAATTCAGAAAAAAAAA
ATTAAGAAAAAGAAAACGAATTAAGAAAAAAAAATGGTCTTCTTCTTCAGGTGTATGCTGAGAAGTATGCCGAAGATCAGGAGGCATTCTTCAAGGATTATGCAGAGGCCCACGCAAAGC
TCAGCGATCTTGGCGCAAAATTCGATCCTCCCGAG
AGGTGCGTTCTCCGAAAATATGAAAAATATTCCTCCTGAGAGCGGGAAATTTTCTGTAATTCGCGTCTCCCTTCCCTAAAATAAT
CCCAATTATGGAAATTATTCGGCAGGGTTTCTCCATAGATGACGATCCCAAGGAAGCCAAGCCGGAGAAGTTCGTCGCCGCCAAGTACTCCTCCGGAAATATGTCAGTCATACCCTCATT
TTTATCCCCTGACTCTGGTTAAATAATTTACAGATGCATATATAATTTATAAATATTTAATATGGTAGAGAGAGAGAGAGAGAGAGAGAGAGAGTGGAGGATCTAATATGATGCTCTGAA
TGGCAGAGGGAGCTGTCGAACTCGATGAAGCAGAAGATTCGGGCAGAGTACGAGGCGATCGGGGGGAGCCCTGACAAGCCGCTCCAGTCAAACTACTTCCTCAACATCATGATCTTCATC
GCCGGATTGGCCCTGTTGACTTCTCTTCTTGGGAACTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGGCGATTCTGCCCTCACCGGCCTCCATCTCCGGCCTCGGGGCCTCCCTGGCCGGGCCCTCCGCCGCCGCAGCCGGCGGCGCCGTTTCGTCGAGGAGGGCGGTGACGTTGTCGTCC
CTTCTTCTGTCGCCGCGATGCTCCGCCCTCCCCTCTTCCTCTCGCCGCATCTCACTCAAGGGATCTCCATTTTCCCCTCTCCGCCTCCACTCCCAGAAG
AATGCGCGCGGCGGGGCGGTG
CGCAAGTCGTCGGGGGCCGCCTCCGCCACGTCCTTCGCGTCGGATCCTGGCCAGTTGAAGAGCGCGAGAGAGGACATCAAGGAGCTCCTCAGGACGAAATTCTGCCATCCCATCATG
ATT
CGGCTTGGATGGCACGATTCTGGAACCTACGACAAGAACATTGAAGAGTGGCCCAAAAGAGGCGGAGCAGATGGAAGCCTGAGATTCGAGCCAGAGCTGAGGCATGGAGCTAACGCCG
GT
CTCATAAACGCCTTAAATCTTCTTCAGCCTATCAAGGATAAGTACCCTGGAGTTACATACGCAGACCTGTTCCAATTAGCCAGCGCCACAGCGATCGAG
GAAGCCGGCGGCCCGAAAATC
CCCATGAAATATGGTCGCGTGGATGTCACTGACCCCGAGCAGTGCCCTGAAGAGGGGAAGCTTCCTG
ATGCTGGCCCACCTTCTCCAGCCTCCCATTTACGGCAAGTGTTCTACAGGATG
GGCCTCGGTGACAAG
GAAATAGTCGCATTGTCCGGTGCCCATACTCTGGGAAGATCAAGACCCGAACGCAGTGGGTGGGGCAAGCCAGAGACCAAGTATACAAAAGATGGGCCGGGCGCC
CCCGGAGGTCAATCGTGGACTGTGCAGTGGTTGAAGTTTGACAACAGCTACTTCAAG
GATATCAAAGAGAAGAAGGACGAAGATCTGCTGGTGCTGCCCACCGACGCTGCTCTATTTGAC
GACCCATCCTTCAAG
GTGTATGCTGAGAAGTATGCCGAAGATCAGGAGGCATTCTTCAAGGATTATGCAGAGGCCCACGCAAAGCTCAGCGATCTTGGCGCAAAATTCGATCCTCCCGAG
GGTTTCTCCATAGATGACGATCCCAAGGAAGCCAAGCCGGAGAAGTTCGTCGCCGCCAAGTACTCCTCCGGAAATAGGGAGCTGTCGAACTCGATGAAGCAGAAGATTCGGGCAGAGTAC
GAGGCGATCGGGGGGAGCCCTGACAAGCCGCTCCAGTCAAACTACTTCCTCAACATCATGATCTTCATCGCCGGATTGGCCCTGTTGACTTCTCTTCTTGGGAACTGA

Retrieve as FASTA