Entry information : SpolAPx-R (Spipo21G0000700)
Entry ID 13237
Creation 2015-06-09 (Christophe Dunand)
Last sequence changes 2015-06-17 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2015-06-17 (Christophe Dunand)
Peroxidase information: SpolAPx-R (Spipo21G0000700)
Name (synonym) SpolAPx-R (Spipo21G0000700)
Class Ascorbate peroxidase related    [Orthogroup: APx-R001]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Araceae Spirodela
Organism Spirodela polyrhiza (great duckweed)    [TaxId: 29656 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SpolAPx-R
start..stop
S start..stop
LminAPx-R02 433 6.36e-153 1..319 39..401
LminAPx-R01 424 2.59e-149 10..319 48..403
CescAPx-R01 389 5.77e-136 1..316 2..353
NnAPx-R01 374 1.72e-130 85..319 102..334
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '13237' 'join(66019..66217,67023..67190,67316..67386,67604..67646,67740..67836,68184..68267,69177..69301,69431..69500,69590..69692)' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 66019..66217 197 N° 2 67023..67190 166 N° 3 67316..67386 69 N° 4 67604..67646 41
N° 5 67740..67836 95 N° 6 68184..68267 82 N° 7 69177..69301 123 N° 8 69431..69500 68
N° 9 69590..69692 101  
join(66019..66217,67023..67190,67316..67386,67604..67646,67740..67836,68184..682 67,69177..69301,69431..69500,69590..69692)


exon

Literature and cross-references SpolAPx-R (Spipo21G0000700)
Protein sequence: SpolAPx-R (Spipo21G0000700)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   319
PWM (Da):   %s   34692.73  
PI (pH):   %s   8.68
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MTTAATTAVPSRFPFPRSRRTALRHPGDPRPRCPLRRRRTPTECLRGEQVENPCSSSSSSEGHRGTVHDVCLLIFAVSRAVESGESLLVRTEVRKVLSKSKAPGVLRLAFHDAGTFDMND
GT
GGMNGSIILELDRPENAGLRRSVVLEKAKSELDKVQNVSWADLVAVAGAEAVSLCGGPVIPIQLGRMDTSIPDPEGKLPQESLGAFDLKKCFFEKGFSTQELVTLSGAHTLGGKGFGS
PIVFDNTYYKILLERPWASS
GSSMSSMVGLPSDHALVEDAECLRWITIYAADERKFFEDFKRAYIKLVNTGASWRNV

Retrieve as FASTA  
Remarks Complete sequence from genomic (8 introns). Incorrect prediction from Phytozome (two first exons are missing).
Promoter
Send to BLAST
Send to cis Analysis
.........1 .........2 .........3 .........4 .........5 .........6 .........7 .........8 .........9 .........0 .........1 .........2
CGGCAGTTCG CATCCAGCGG CGGAAGAAAT CGTCGGAGGC GCCTCTCCAC GATGGCTCCT CCGATGAGGA GGACATCTAC CTGGACAGCA TCTCCGGGAT GCCCGTACGC TTCACCTACG  GGGATCTCCG GCAGGCAACA GACGACTTCT CGGTGAAGCT CGGGAGCGGC GGCTTTGGGT CGGTGTACCT CGGTAAGCTT CGAGATGGGT CCCGAGTGGC AGTGAAGAAG CTGGAGGGCG  TACACCAGGG AACCAAGGAG TTCCGGGCGG AGGTCTCCAT CATAGGCAGC ATCCATCACA TCCATCTGGT CAGGCTCCGG GGCTTCTGTG CAGAGGGCAG CCACCGGCTT CTGGCTTACG  AGTACATGTC GAACGGATCG CTGGATAGGT GGATCTTCCG CAAGGACAAG GAAGGCCATC AGCTGGACTG GGAGAAGAGG TTCAACATCG CCCTGGGCAC GGCCAAAGGT CTGGCGTACC  TCCACGAGGA CTGCGAATCC AAGATCGTCC ACTGCGACAT TAAGCCGGAA AACGTCCTCC TGGACGACAA TTTTGAGGCC AAGGTCTCCG ATTTCGGGCT GGCAAAGATG ATGACCCGGG  AGCAGAGTCA TGTGTTCACG ACGATGAGGG GCACGAGGGG GTACCTCGCG CCGGAGTGGA TCACGAACTA CGCGATTTCG GAGAAGAGCG ACGTATACAG CTTCGGAATG GTGCTGCTGG  AGATCATTGG AGGCAGGAAG AACTTCGACC CGTCGGAGAC CTCGGAGAAG GCGCATTTCC CATCCTACGC TTTCAAGATG ATGGAGGAGG GGAAGCTGAG GGAGGTGCTG GACTCGACGC  TGCTGTTGAG CGACAAGGAC GACAGCGTGG AGACGACTAT TAAGGTGGCA TTGTGGTGCA TCCAGGAGGA CATGACGATC AGACCGTCCA TGGCCAAGGT CGTGCAGATG CTCGAAGGTC  TGACGGACGT TCCTCAGCCC CCGACATCCT CCCAGATGGG CTTCCGACTC TATGCGAATC TCATCAAGAC CATGAGCGAA GAGGGCTCCT CTGCCGCGTC GGGCCCCTCT GACTGGAACA  GTGAAGCCTT GCTATCGGCG GTGCGGCTGT CCGGACCCAG ATAGCAAGAG GTGTTACGAG GTGGGTTCCT GGCACCTCCG ATCCTGCGGA GCCCGCCGTC TCGCGGACGA GACCGCCGGA  GCCGACGGCA ACTTCTCTCC ATCGTCGGGT TGGGGTGCTT CCCCTCTTGT TGGAGAGGGC TCCGAATTCC ATTTAAATTT TCAATTCTTT ACTTTCGACG GAATCGGACC ATCATCGGGG  ACCTCCGCGG GTCTCCTGCT TGTCTGCGTC ACATCTTCTT GCTCAGACGC CCATTCTTGT TCTTCCGGGG ATTGTGGGTG GGCATTATTT CGAGTCGAGC TTCGAGGGCG ACGCCGGCGG  ACATCTCCAC TCCTCCCCAC TTGCTCTATC CTTTCGCAGC GCGACGGGAC CCGATTCCGT TTCCCATGCT TTCCAGCTCC AAAGTGCGTC CAGTTCCGGT GGACAAGTCC GAGACCGCCC  GACGCTCTTC CTCGCCCCTC CGTGTACGGC CGCTGGCCAT CTTGACCCCA GGGGATCGAG GCCCCCCAGC ATCGTCGTGA TATGATCCGC AATCTGCTGG CCTCGAGTCT CCTCCGGTGG  CCGAGGCGAC GCCAGGGTCT TTCTTTGTTT CCTTCCATCT AAGCGTGCCC GACGGGTACT ACCTCATCGT TCCCCGCTGA GAGGCCGGGA AGGTCCACAC ACACACACAC CCACGTACAG  CCCTGCCTCA ATAAACGGGC TTCTCTTCTT GCTACTTGGA ATTCAAACTG GCTCGAGGCT CATACCCCGT CCCAATGGGC TGACCTCGGA CGAAGTCCAG CCCGAGGTAT TTTAGCTTAA 
GCCTGGCCTC CCACCACCGC TCACGCCAAC CGACCGCAGG CTACCGCTGG TTTCTCCCGC TTCCCTTCCT CTTGCGGGGC 

Retrieve as FASTA  
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGACGACCGCGGCGACCACCGCCGTCCCCAGCCGCTTCCCGTTCCCACGTTCAAGACGAACAGCGCTTCGGCATCCAGGAGACCCACGGCCACGCTGCCCACTCAGACGCCGCCGGACG
CCCACCGAGTGCCTGCGAGGGGAGCAAGTGGAGAACCCCTGCTCGTCCTCATCCTCCTCGGAAGGACACAGGGGCACAG
AGGTGACGATATCCCCTTTTTCCTCGCTGGATCCTCTTCAA
CACCATCCCCCTTCCCACAAGGAGCTCTCTCCTTCTACTGGACGAACAGCCATAATCATTCATGCACGGGCATATATTGACCCATGCCCGTACCTTTCATCGATAAAATTTCTATTTTGC
GTTGTGGATGCCACCTCTACAGAAAATTCGCCCCCCTTGCCTTTTTTTCATCTCTCCTTAGGTTTTATTTGCCCATAATTTGACTGCAGGGGAGAGCAGGTCCTTCGCCTTCTACGGAAG
AAGATTTTTCTTTCTGGCCACGGCTCCGTTGTTGCTCTCCAGTCAAGGCTCATCAGAATACTCCAATGCCAATTCACTACAGTATGTTTCATAATTTCCTTTCCGCTTCCTATCTTCCCT
CTGAGGCAGCGGCCTCCAAATCCGCCCGATTCCTTGAACCCTGCGAGACTAGTGTAGACATGAACCCGAGTTCTGTAGTTCGATGGTCTGCTGCCTCTCGGTTCCGCCATGCTGCTTCAG
TTTGACCGCATCCTTTCAAAACATTTTATACATCAATAAAGTAATAGAGGTCGATAAGTCACAAAAAACAATCTTAGAGATCAGTAAAGTTCTGGTAGAGTTGTGGCATCTTTCAAGAGA
CGAGAGCAACGTGCCAGTTTGGTAGCAGCCCAGTGGGGTTCAAGCAATGCTCTCGACAGGTGATGTCGGCGAGCTTTTGCATGTGGCCACAAGGAGTGCTGGGCTAGATCAATGGCGCAT
ACCAGGAGAAATTTAATTCCTTTCTTTTAAATTTCTGCACTTTGAGTACATGATGTCTGTCTTCTCATATTTGCTGTCAGCAGAGCAGTAGAGTCTGGCGAATCTTTGCTTGTTCGAACT
GAGGTAAGGAAAGTCCTTTCAAAGTCCAAAGCTCCTGGGGTACTTCGGTTGGCCTTCCATGATGCAGGGACATTTGACATGAATGATGGCACAG
AGGTTTATTTTGGAGCTAGAACTAGA
GAACGTTTCATGTCTCTTACTTTTGTCTACTCTACCTTGAATGGTGTCACGCAACATCAGGCTGTCTTTTAATGGATTATATGCTTTACGTTTCCTTGCAGGTGGAATGAATGGCTCAAT
TATTTTAGAACTTGATAGACCTGAAAATGCAGGTTTGCGTAGATCTGTGAAG
AGGTGTGTCTGTTTTTCATCCTCTCTTTCGTGCATGTTTACGTGTTCAAAAAATATTTTTGTCTAGTT
GGTGAACATATATTATTGCTTCGTATCATGACCACCCACGCTCATTTTGGTGGATTATTACATGATATTATTTATGATTCTTCTTTTGTCGGTCTCTCCCTGTCTATTTATCCTCTTATC
GACTCTCCACTTTGTTTTCTTTTCTGATTAGGTTTTGGAAAAAGCAAAGAGCGAGTTGGATAAGGTTCAGAATGTGGTATGACTTTCCTATTCACTGTAATTCATGTGTTCCTGCACGTG
ATTATTCTCTCCTCTTCTTGAAATTTATCATGGGTTACACTGGTGTCAGTGTCCTGGGCTGATTTGGTTGCTGTGGCTGGTGCGGAAGCCGTTTCGTTATGTGGAGGTCCCGTCATTCCT
ATTCAGTTAGGCAGGATGGATACAAG
AGGTTAAATTTCACCTTACAAACATTGCACTCTTGCTAAGAAAAAAAAGAAGAAGAAGATGGATACAGGGTAATTAGTCCCGACTGTGTGATCA
AATCGGTCGATGGCTGTTTATGTGAATAAAAATTATCGATAATGCCTCCTTGAATATCTTATGAATTTTTCTCTTCTGATACGTAATTTTGGGTTTCTTGGAGGTTTACTTTCACAAGCA
GAAAAATTAAAGCCGATGACCTGATCCCTTTCTTGGTTAAATTCTATATAATGACAGGTCTCACCCCTTTTTTAACGGATGGTCAGTCGCACCTGAACCACCAGTCTTCTAACCTTTGGA
TTTTCTATCATCCAGTATACCAGATCCCGAGGGAAAACTTCCCCAAGAGTCGCTGGGCGCTTTTGACTTAAAGAAGTGTTTCTTTGAGAAAGGCTTCTCTCGTGAGTAAATATTCTCATG
CCATGGCATGGGTTTTTTCTTTTCTTTTGCTTTTTCTCTTGTCTATGTTACTCTACCTGTTTTGCGTAATCAGCATAATTTAAACGGATAAATCTGTGTTTATTAATATGCTACAAGCTT
TTCCATTTCACCCGATTTTCTCTGCTGTATACTTGAAGGTTATAAGTTTTTTCCTTGTGCATGTATGATGTTCCTGGGGCCACTCAGCTCAAACTCCTCATGGGTAGGATGTAATTTGGT
CCTCTGGTCATTCTAGTCGAAAAATAACAGTCCAGCGTAGTCTGTGTATAGTAGAAATGATGCGCGTGAAGATGGTGCAAAGTCAGATTATGCTCTGTTCATATGATTTGATGTGGACCT
ACCAAGTCTTTTATTAAAGTCAGATTATGTCTCATGTTTACTGGGCACACGTTAGATGTGCGCAGAGTTCTTTTATAAAAAAAATAATAATGTCATGGGAATTCCGATAATGATGGGTTT
TGCAGTGTATCAGAGCTTTTCCACCGTCGAGAACTTGTGATATTTTTTGCAAACGTTCCATGTTGCTCTTATGTCTAGTATGTATGCCTCTGCATTCCTCTCCTCTATCGTCGACGATCA
AGTTTGCTTTGCTCAAATATGAATGACAAAACGCTTTGATTATTCCTTCGATTATTCCTGTGTTGTTTGGACCTGCAGTGTCAATAAAAGATTTTGGAAAGCCGTTGAACCTTGTCGAAA
TCGTCCAAATGCTAAAGCCTAGAACGTCGTTTTTTGGCAAATTTGTCTTGTTATGTCAGCTGTTATTCAAGAGAACTTGCGGCGGCACGAGTCCGTCTCATGCCGCCGCGGGTTTTCTGT
TGCGGCCATCCTTTTGCTGCTGCAGTGTGAACTCGAGGGTCAAATTGCAGAACACAAGAACTGGTCACATTGTCTGGAGCTCATACGCTGGGAGGAAAAGGCTTTGGGAGCCCAATCGTC
TTCGACAACACCTACTACAAGATACTCTTGGAGAGACCGTGGGCGTCGTCCTCCG
CGGTGAGTAGCCAGATGCCCGTCTGTGCAAATTGACCGCATTTATTCTCCTCTGGGGATCTCATT
TGGCGGCGCTTTTTTCCTCCGCGGACTGCGACTTATGGTGGCCGGGCCTTTCTGCTGCAGGCTCAGGCTCTTCCATGTCGAGCATGGTCGGGCTCCCATCAGACCATGCGCTCGTCGAGG
ATGCCGAATGTCTGAG
AGGTCCCTACTGATGGCATTGGTCTCTCTTTCATTCCCGGCGCACTGCACCGGGGGGCTTGATGTCTGAGGCGCCTTGCTTGCTGTTGCAGGTGGATCACGATT
TACGCAGCTGATGAGAGAAAGTTTTTTGAAGATTTCAAGAGGGCGTACATTAAACTGGTCAACACCGGCGCGTCGTGGAGAAATGTCTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGACGACCGCGGCGACCACCGCCGTCCCCAGCCGCTTCCCGTTCCCACGTTCAAGACGAACAGCGCTTCGGCATCCAGGAGACCCACGGCCACGCTGCCCACTCAGACGCCGCCGGACG
CCCACCGAGTGCCTGCGAGGGGAGCAAGTGGAGAACCCCTGCTCGTCCTCATCCTCCTCGGAAGGACACAGGGGCACAG
TACATGATGTCTGTCTTCTCATATTTGCTGTCAGCAGAGCA
GTAGAGTCTGGCGAATCTTTGCTTGTTCGAACTGAGGTAAGGAAAGTCCTTTCAAAGTCCAAAGCTCCTGGGGTACTTCGGTTGGCCTTCCATGATGCAGGGACATTTGACATGAATGAT
GGCACAG
GTGGAATGAATGGCTCAATTATTTTAGAACTTGATAGACCTGAAAATGCAGGTTTGCGTAGATCTGTGAAGGTTTTGGAAAAAGCAAAGAGCGAGTTGGATAAGGTTCAGAAT
G
TGTCCTGGGCTGATTTGGTTGCTGTGGCTGGTGCGGAAGCCGTTTCGTTATGTGGAGGTCCCGTCATTCCTATTCAGTTAGGCAGGATGGATACAAGTATACCAGATCCCGAGGGAAAA
CTTCCCCAAGAGTCGCTGGGCGCTTTTGACTTAAAGAAGTGTTTCTTTGAGAAAGGCTTCTC
AACACAAGAACTGGTCACATTGTCTGGAGCTCATACGCTGGGAGGAAAAGGCTTTGGG
AGCCCAATCGTCTTCGACAACACCTACTACAAGATACTCTTGGAGAGACCGTGGGCGTCGTCCTCCG
GCTCTTCCATGTCGAGCATGGTCGGGCTCCCATCAGACCATGCGCTCGTCGAG
GATGCCGAATGTCTGAG
GTGGATCACGATTTACGCAGCTGATGAGAGAAAGTTTTTTGAAGATTTCAAGAGGGCGTACATTAAACTGGTCAACACCGGCGCGTCGTGGAGAAATGTCTAG

Retrieve as FASTA