Entry information : SpolGPx04 (Spipo0G0143700)
Entry ID 13258
Creation 2015-06-19 (Christophe Dunand)
Last sequence changes 2015-06-19 (Christophe Dunand)
Sequence status complete
Reviewer Catherine Mathe
Last annotation changes 2016-03-07 (Catherine Mathe)
Peroxidase information: SpolGPx04 (Spipo0G0143700)
Name (synonym) SpolGPx04 (Spipo0G0143700)
Class Plant glutathione peroxidase    [Orthogroup: Gpx2001]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Araceae Spirodela
Organism Spirodela polyrhiza (great duckweed)    [TaxId: 29656 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SpolGPx04
start..stop
S start..stop
VvGPx06 269 4.6e-94 4..168 2..166
PtGPx06-1 268 1.68e-93 4..168 2..166
BnGPx06-1_other 266 6.93e-93 1..168 1..168
EgrGPx06 268 1.39e-92 2..168 82..248
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '13258' 'join(9584358..9584411,9584841..9584917,9585048..9585109,9585316..9585434,9585765..9585932,9586025..9586057)' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 9584358..9584411 52 N° 2 9584841..9584917 75 N° 3 9585048..9585109 60 N° 4 9585316..9585434 117
N° 5 9585765..9585932 166 N° 6 9586025..9586057 31  
join(9584358..9584411,9584841..9584917,9585048..9585109,9585316..9585434,9585765 ..9585932,9586025..9586057)


exon

Literature and cross-references SpolGPx04 (Spipo0G0143700)
DNA ref. Phytozome 12:   pseudo0 (9584358..9586057)
Cluster/Prediction ref. Phytozome Gene 12:   31508669
Protein sequence: SpolGPx04 (Spipo0G0143700)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   170 (279)
PWM (Da):   %s   18753.51 (29910.8)  
PI (pH):   %s   8.05 (4.67) Peptide Signal:   %s   cut: 24 range:24-302
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASAAPTSPRSVHDFSVKDARGNDVDLSIYKGKALLIINVASQCGLTHSNYTEMRQVYDKYKNKGLEILAFPCNQFAAEEPGSNEQILEFACTRYKAEYPVFAKIDVNGKNAAPLYKFLR
SSKSGLSGGDIEWNFAKFLVNREGDVVGHFAPNTSPLNIEKDIKKVLGEP*

Retrieve as FASTA  
Remarks Complete sequence from genomic.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTCCGCAGCCCCAACTTCTCCCCGGTCGGTTCACGACTTCTCCGTGAAGAGGTACGTCCGAGATAGGATCGAGAACGCGTTTGATGTGGTTTTTGGGTTCCGGACTTCACCGTCT
TCGTCGTTTGAACGTTCTTCGGAACCAGTGGGAGATCGATTTTTAAGGAGCGGTGATACTGGTTACTCTTGTAATCGGTGGCCCGTTCGTAGCTTGTTCGTTCATCATCGGCAACCGGGA
CGCCTGAGGAAATTTTGGCATTCCCTTCAAATCGTTTCAGTTAAAGTAGATCTATCTCGTGTATTCAGGAGATTGCCACGGCTGGACGCTGTCGTGCGCAGCAGATTTCTTGAGTCTCTA
TGAACCCTACAGACTTCAATCGAGCCGAACCCTAATTATTCGGTTCTATGAGTCTCTTCTTTTGAAATGCCCATCGACTACCAGTTTTTATGATGGGCTATACTGTTCTGTCGGCTTTAA
CACAGGATGCCAGGGGAAACGACGTCGATCTCAGCATCTACAAGGGGAAGGCACTGCTGATCATCAACGTCGCGTCACAATGTGGTATCATCGCTCTCTGCTCGCTCTGTTTGGAAAAAA
AAAAAAAGTGCGACCAAATTGGAGATTAACATTTCTATCTGATATCTTTTTAAGACGAGCCTCACGGATCTTTTCTTCCTTAAATCTGCTGCAGTGGATTGACCCACTCCAACTACACTG
AAATGAGGCAGGTTTACGACAAGTACAAGAACAAAG
AGGTACTGTGGTCTTGACTCTGGCTGGTTCGGTCAACATCTATCCGTTACCAGTCACCGTCATTCCTCGCAAAGGACCATTATT
GAGAGCATGTTCCCCACAAACTAGCAGTTTTTCACTTAAATTTGTCATTTTATGCCCTTACAAGCGATTTTTCTGTTTTTGATTCCTGGAACGACATCTGGAGCATATTTTATTTATCCG
GCAGGTCTTGAGATCCTGGCTTTCCCCTGCAATCAATTCGCGGCAGAAGAGCCGGGCTCCAACGAGCAGATACTGGAGTTTGCCTGCACTCGCTACAAGGCGGAGTACCCCGTATTCGCC
AAG
AGGTGATCAGAAATACTGCCGCCTGGTTGTTCTTCAGCGTTGCCAAAATTGGGTTCATCTTCATTCGTTTCTGATTAAACATGTTGCGAGAGTGTACAATCTGGCTGTCTGTGGTCG
TTCCAAACGTAGCCGGACTATCTGGGGTCCCTTGAGGAAAGTGGCGAGCTACAGATAGAAGCATCGCCATGTGGCTACTTTCTTCGATCCGATTCATTTGTGTGATCTCACCTCTGAGCA
GAAGCTATTCTCATGATGACTTCTGTGATTTCATCTTCTACGATCTCGTCATGGTTGTCCCGTTGACCCTCATTTTATTCTCCTGCCGGGACTAGATCGACGTGAATGGGAAAAACGCGG
CTCCCCTCTACAAGTTCTTGAGGTCGAGCAAATCCGGGCTCTCAGGAGGTGATATCGAGTGGAACTTCGCCAAGTTCTTGGTCAACAGAGAAGGGGACGTGGTGGGTCACTTCGCCCCTA
ACACCTCCCCTCTCAACATTGAG
AGGTAAAGGAACTCTCTCTCTCTCTCTCTCTCTCACCCACACACACACACCAATCCTGCGATTTGTTGAACTGTTTTTGAATGGTTTATCGCAGAAG
GACATAAAGAAGGTGTTGGGCGAGCCGTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTCCGCAGCCCCAACTTCTCCCCGGTCGGTTCACGACTTCTCCGTGAAGGATGCCAGGGGAAACGACGTCGATCTCAGCATCTACAAGGGGAAGGCACTGCTGATCATCAACGTC
GCGTCACAATG
TGGATTGACCCACTCCAACTACACTGAAATGAGGCAGGTTTACGACAAGTACAAGAACAAAGGTCTTGAGATCCTGGCTTTCCCCTGCAATCAATTCGCGGCAGAAGAG
CCGGGCTCCAACGAGCAGATACTGGAGTTTGCCTGCACTCGCTACAAGGCGGAGTACCCCGTATTCGCCAAG
ATCGACGTGAATGGGAAAAACGCGGCTCCCCTCTACAAGTTCTTGAGG
TCGAGCAAATCCGGGCTCTCAGGAGGTGATATCGAGTGGAACTTCGCCAAGTTCTTGGTCAACAGAGAAGGGGACGTGGTGGGTCACTTCGCCCCTAACACCTCCCCTCTCAACATTGAG
AAGGACATAAAGAAGGTGTTGGGCGAGCCGTGA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTCCG CAGCCCCAAC TTCTCCCCGG TCGGTTCACG ACTTCTCCGT GAAGGATGCC AGGGGAAACG ACGTCGATCT CAGCATCTAC AAGGGGAAGG CACTGCTGAT CATCAACGTC  GCGTCACAAT GTGGATTGAC CCACTCCAAC TACACTGAAA TGAGGCAGGT TTACGACAAG TACAAGAACA AAGGTCTTGA GATCCTGGCT TTCCCCTGCA ATCAATTCGC GGCAGAAGAG  CCGGGCTCCA ACGAGCAGAT ACTGGAGTTT GCCTGCACTC GCTACAAGGC GGAGTACCCC GTATTCGCCA AGATCGACGT GAATGGGAAA AACGCGGCTC CCCTCTACAA GTTCTTGAGG  TCGAGCAAAT CCGGGCTCTC AGGAGGTGAT ATCGAGTGGA ACTTCGCCAA GTTCTTGGTC AACAGAGAAG GGGACGTGGT GGGTCACTTC GCCCCTAACA CCTCCCCTCT CAACATTGAG 
AAGGACATAA AGAAGGTGTT GGGCGAGCCG TGA 

Retrieve as FASTA