Entry information : EsilCcP01 ( Esi_0009_0009)
Entry ID 13370
Creation 2015-08-04 (Christophe Dunand)
Last sequence changes 2015-08-04 (Christophe Dunand)
Sequence status complete
Reviewer Achraf Jemmat
Last annotation changes 2016-02-10 (Achraf Jemmat)
Peroxidase information: EsilCcP01 ( Esi_0009_0009)
Name (synonym) EsilCcP01 ( Esi_0009_0009)
Class Cytochrome C peroxidase    [Orthogroup: CcP004]
Taxonomy Eukaryota Phaeophyceae Ectocarpaceae Ectocarpus
Organism Ectocarpus siliculosus    [TaxId: 2880 ]
Cellular localisation N/D
Tissue type Sporophyte
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EsilCcP01
start..stop
S start..stop
CsinCcP03 500 1.04e-180 94..357 1..264
PlaCcP02 496 4.34e-179 94..357 1..264
PfasCcP01 494 3.43e-178 91..357 3..269
DvirCcP01 480 5.36e-173 94..352 1..259
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '13370' 'complement(join(56207..56318,57206..57297,58359..58470,59585..59761,60551..60655,61068..61193,61906..61967,62773..63060))' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 62773..63060 286 N° 2 61906..61967 60 N° 3 61068..61193 124 N° 4 60551..60655 103
N° 5 59585..59761 175 N° 6 58359..58470 110 N° 7 57206..57297 90 N° 8 56207..56318 110
complement(join(56207..56318,57206..57297,58359..58470,59585..59761,60551..60655 ,61068..61193,61906..61967,62773..63060))


exon

Literature and cross-references EsilCcP01 ( Esi_0009_0009)
Literature Cock,J.M. et al., The Ectocarpus genome and the independent evolution of multicellularity in brown algae. Nature 465 (7298), 617-621 (2010)
Protein ref. GenBank:   CBN73902.1 UniProtKB:   D8LTK5
DNA ref. GenBank:   FN649137.1 (63060..56207)
EST ref. GenBank:   FP291071.1 [5' end]  FP251850.1 [3' end]
Protein sequence: EsilCcP01 ( Esi_0009_0009)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   357
PWM (Da):   %s   38180.9  
PI (pH):   %s   8.16
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MKLTVAMVAALSARESLAFVPSFNAVRSTSSTAAAQGNMCTVRMAAGMDQGASEMSSVPMGRKQMLQSAAAAAFGAAFVSANPSQSFADSSVDYKKVRADIEGIMDKDGSKGPTLVRLAW
HSSGTYDKISKTGGSQGGTMRFSQELADGANAGLNNAV
GWLEPIKKKYPSISYGDLYTLAGVTAIEKMGGPTIKWRSGRKDDDVAAVPPGGRLPAADKGNPMATAKGLRDVFYRMGFNDR
EIVALSGAHALG
RCHTDASGYDGPWTPTPNLFTGATYFKLLKSISWSERDFTPFQYQDPSGSLMMLPSDIVLLEDKSFKKYVDMYADNDKLFFEDFSKAFATLLELGTKDLVEESA

Retrieve as FASTA  
Remarks Complete sequence from genomic (7 introns) and 5 ESTs.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAGCTGACCGTGGCAATGGTTGCGGCCCTGTCCGCACGCGAATCCCTGGCGTTCGTGCCGTCTTTCAACGCTGTAAGATCCACGTCAAGTACGGCCGCTGCTCAGGGCAACATGTGC
ACGGTGCGCATGGCAGCGGGCATGGACCAGGGAGCAAGCGAGATGAGCTCGGTCCCGATGGGCCGCAAGCAGATGCTGCAGTCCGCTGCTGCTGCCGCGTTTGGGGCGGCCTTTGTCTCG
GCGAACCCGTCCCAATCCTTCGCCGACAGTTCGGTCGACTACAAGAAG
GCAAGTTGTAGGAACAGCAGCCGACGGCGGGCTTGGCTTGGAGGCACCCAACCCGCTTGCGATGTCTCCCTG
CGACGGCTCGGATTTTGCTTTTGTGCACCAAGGGGTAGCAGCTGCTGTCGGCCGTAGAGGAGAGAGAGATCCCCGTGCCGTGTTGAGGAGGCATCGCAAGCTGTTCTGTAGATATCGCGG
GTGTTGTTGTTGCACATGCGGTCAACGATGATGCACCACACAGAACAAAGGAACAGACACAAGCGCGCGCGGAGCGACTCTTGTGCTTGCAGCACGTCTAGACCAAGACAGCGGGTAGGG
ACAACAATGTTGCGGATGAATACATAGAAGGGTCGCGTGTTGTACAACTAGAGCGCGGGTTTGTGGAGCAGAGAAGGACGTCCTGAGGCGATGGTGTCTGAAAGGTCAAGATATCAGAGG
ATCAGAGGTGACTGCTGTGTCGAATTCTTATGTGACCGTTGATGGGTCTCTTCAACATCTAGTTCAAGTGGTCCGATCATCCGATCAATCCGATCAGATGATCAGATGTTAGGATCTTAA
GTCTATCCCCCCGCAGTCACGAGTTAGATATCAGCAAGATATCAGACTGCTGTACGCATAATCCATGCACGTATGTGCAAGTTACACGTATCTATTGGTACTCGAGACACAGGGGATATA
GGAGGGTTGGTGTGCCGCTCTTGCCAAAGGCAACGTCAACACCTTAACCCCTCTTGCAACTATCTGACGACCAACCTTCGGTGATATTTTCGCTGTGCATTCCGCGCTTCTTGTTGCGAC
AATGCCACGTTAGGTGTCCGGGCGGATATCGAGGGCATCATGGACAAGGATGGCAGCAAGGGACCCACTCTAGTCAGGCGAGCCTAGGAAACATAGTATAGCAGGTTGTGGCTGTGCTAG
CAGGAGCGAAGTGTGGAAGAACATCGTAGAGATTACTAGAAATACCGTATTTCAAATACCTTACGGAGTGGTATTTCGTACCATGAACTGCGCATACACTGTTGTATGCGGCGGTACTGC
TGTAACAGCGGACACACCAACGAAGGTTCGATTTGTTGTTTGCGTGTGTATGTATCTCGCGAGACCACTCCAAGAGTTAAGAATAAGAGTTTTGGGTGCGTGTCTCTTGTGAGACTCTCA
AGTTCACAACAGCAGTGGTCTATGTGGCAACCATCCATGCCTTACAAGGTCGTGTGGTTGCTTCCGCTTCGTCGGAGGTATCGTATATAAAAACCACTTACAGGTACAACCGATCTAGGC
TGTCCTTGCTCCTTTGTGGGCATCATGCAATCTTGCTCGTGTGTTTGGGCTGGTCATGTTCATGTCTTCTTTTGGTTGGTCACACTTTCGTGTCCTTTACATTTTTGTACAAACGCTCTA
CTGCCTAAACAGCAGTGTTGCAACAGACTAACACGTCCTCCTGTGTCGGCGTCATGTAATCTTGCTCGTTTTTGGTCTTGCATCATGTCTGTGCCCTGCTTTCTTGGTTGGTCACACTTG
CATGCCTTTTCCATTTTTTTTGTTGTTGTTGTTGCCGTTTGTCTTCGTCCTTTGTCTTGTCTTGGCCAGGCGCTGGCGTGGCACTCTTCCGGAACTTACGACAAGATCTCTAAGACGGGA
GGCTCCCAGGGTGGCACCATGCGTTTCTCGCAGGAGCTCGCGGACGGCGCCAACGCTGGCCTCAACAACGCCGTGGG
GTAAGCACTTATAATGAGCGCTTTACAAGTAGACACATACCCT
ATTTAGCAAAAGAAGTAACACGTGTAGCAACCGGTTATTCGAACGAGAAAGTTCTGCTTGAAAATGACCAGTACAGCACAAGGCAAGCCCTTCTCCAAGACATCGAATACCCAGACAACT
TCATTAAATGAGAATGAGGCGGGAGATACCGTGAAGCCTGGCAGCTAGATGTGTTGCGTCGGTTGACGACATCACTGGAGGTGCCTTGCTCGTGCTTCCTTGCCTTCGACGGCTGTTCTG
ACTCAAACGATCGACGGTAACAACTGCAATCATTTCCATCGAGAGTGTTTTTTATTTTCCTTTTTTGACACGCCTAGGTGTGCCATCTTCCAACCCCTGTGCCTCTATGTGCTTGTTTTG
GTTGGACAGGTGTGGTTGGAGCCCATCAAGAAGAAGTACCCCTCGATCTCCTACGGAGATCTGTACACGCTGGCAGGGGTTACCGCGATTGAGAAGATGGGTGGCCCTACCATCAAGTGA
GAGCTCACGTGCACGAAGAAACGCCGTAAACAAAAAAGTAAAGTAGAAGATGTTGTGCTTTTGCCCTGCCCCTACTTCGTGAACTCGGCAACCAGGTTAGCGTTGTTTTTTTTTACCTCT
GTTTTTTTTTGCGGTAACCATGAATGGTGGTCGAGTAGATCATGTTGTGCGGGGTCGAGAAACCTCACTCCGCGCAAGGGGGATGATCGCACCACGTTGTGTTAAAATGGTCGAGCATCC
TCGAGGCAGTTGCACAGTGCTTATAACTGTCTCTGGAAGTGAAAGCACCAGAAAATACCAGGAAATAGACTGAGTCATACGCAGCTGTCATTCGTACGCAAGGAAGTAAGCACAAGATGC
CGAACACCCTTAGCAGGATGCAGCGCACCCTTCATGCGACTCGCCGAATACCTCACGGCGCTTCGCGCTTGGTGATGTGAGAGCCTGGCCCGGTGCGAACCCGGCGTGCTCCGTCCCGAC
TTTGTAGGGGTGCGAGGTCAATGGTCTAACGACTACGGCATGCACGACTATGAGTATGAGATGAGTACACCCTGCTGCTGTGTACCTTTCCCTATAGGTTGCAATGATCTCTGTTTTATT
TTTTACTTCGGTGAGTGGTTCGCGCCCGAAACCTTTTGATTGGAAGCTTCCAGCGCGTTGTACTTTCCTTTTCATGACAAAGAATCTACCCCTATACGGCATGGCATGGCATGATTCCCA
TTTGATCTCTCTTTCTCTTGGTCTCTTGGTCTCTTGCTCCTGTGGCGGTTGCGTCGATGCTAAAGATATGGAGGTCAGGCCGCAAGGACGATGATGTAGCAGCTGTGCCTCCCGGAGGCC
GCCTCCCGGCTGCAGACAAGGGAAACCCCATGGCCACCGCTAAGGGGCTGCGGGACGTCTTCTACCGCATGGGCTTCAACGATAGGGAGATCGTGGCCTTGTCCGGCGCACACGCCCTCG
GAAG
GTACAGACATTTTGTTTTTAAGGGAAATGGACAAAATTGGGTACTCGAACATCCAGCGCGCGCGCCCTCCATAGGCGCGACCCCCAAACGACTAAAAACCCCATTCTGACACCTGG
GCGACACAGCCAGGGACCATACACAGCACGGGCATCGATTTTTTCCCACTTTCAGGCACACCTTTGGCCCTAATACCGCCGATGCGCGCAAGGCCTCACCACAGTGCCCACTTCTGTCCG
ACATCGCGGTGGGTATACCCAGCGGCGTCAACTAATTTTTTCATGTACCCACTTGTGCCTGTATTTTGACCCACTTTTGTCCAAATTGTACCCACTTTTGTCCACTTACGGACGGCGGAA
ATCGAGCGGAAATCGACCTCCACGTCACCGCACGGCAGAAGATCGAATAGCCTCGGAACGTCTCAGAACCGTCAAAACCTCCCAACACCGTATCCATGGCATCTTCCCTATCCATGGCTG
CCGACTGCGGACCGACCGCGGGATACCGGGTCGGATTTTCACTTCGTATATACAAACTGTAGTGCATATAAATACCTTCTTGTTTTTACATGACGTAGTTGCGTGGTAAGCTGCCTCGAC
AAGCTGTGTTGCTGCCCTCACGAGTCGGTGTGCACTCGTTGTGGTGGTTGTGTTTTTTGTGTGTGTGGCGCGTGCGTGTGTCTGTGTTGCTGTATGCGCGTCTTTTTGTTCTGTATGCGC
GCCCGTTGGTTTTGTTGTCCGTTGTGCGTCACGCATTTATTTGTGGCGTGCCGTTAGTGCGCTGCTTGCAGGGCTTGCCGCGGGTATCTTCCCGTGCCGGTACCGAAGGGGTCTGGCATG
TTCCTCCGTGGTCGGTCCGCAGTCGGCAGCCATGGATAGAAAAGATGCCATGGATACGGTGTTGGGAGGTTCTGTAGCATATACACGAGCCAGTTCGAGGGCAATCGCCAACTACCCTAA
TGCACGCTTGAGACAGCTAGCTGACGCTGGTCTAGTCTACGAATACGGTGGAGTGTTTGCGTTAGTTGAGCTTGCGGTGATCCTGTTGCCTCCACCGCCCTTGTCTCGGGTTTGCCTTCC
TTTCCGTCCTGGCGTCACACACGGCACCGGTTACGCAGGTGTGCCACACTGACGCCTCCGGCTACGACGGTCCGTGGACGCCCACCCCCAACCTCTTCACCGGAGCCACCTACTTCAAGC
TCCTCAAGTCCATCTCGTGGTCTGAACGCAAG
GTAAATAGGTGGTGACCCGAATTAGCGGCGACTTCCAATAGCGGATTTGTCCATACAGCGGCATCGAAATGTTTTGTCACCAATCTCA
ACGCGGATGCGAGGGGCTGGTGGGTTAATTGAGCGTTTCGGTTTATTTTCGTTTTGTTTCTTTGTCTCTCGCCGGGGCGGGGTTGTCGAGTGCAATCCCTGAAGTCAACAGGGTGGTAGG
AGCGTAAACCCCAAACGCGAATAAACTTTGGCAACACACTTGCGTTGTCCACTGGAAAGGAAATAATCGCCAGAACCGAGAGGAAAAGCATCTCTTGATCTATTGCACTAGGGAATGGGG
GCCCTGCGGTCTGTAGCTGACATGTACCCGAATGGCCAGAGGGCCCGTCGTGTCATATCTACATAGATCGAATGCACCGCAACGTCTATGCATGGAACAAGACAAGGATCGTTTTGTTGA
GTTCTTGAGGTTTAAATGGACGGGTGGAGGTGTACCCCACCCTTGACAGACCAGACCAGACCAGATCAACGCGGGGCACAAGCATGTGGTAAACGGTAAACATCATGCAGACAAGTACCG
CCCCCTTGCGCGGCCCAAACTGCCCCGCTCTCAATTGTGACCTGCTGACGACAGGAGATTTTGTCTCGGTGAAGTGAAGGCATGGTTGGCACATGGGACGAATGTGCAGGGGGGCAACCG
TTGCTGCCTGTTTCGCATCGCTTCCACGATAGAGCCAAACCTCCGCCCTCGTAGATACCTATCCGCGCTCTACGGCATGAGCATGCGTAGACACGACCACACAGCAGTGAGGAGAGACAA
GCGCGGATAAGATAGAATAACTTGGCCGTGCTGTGTGTGTGCAATTCGTTTGCCCGGTCACATGCTGTGCTGGCCACTTTCGCTGCACTGACAAGTGTCGCTGGCTCGTCACAGGTGCTG
CTAGTACTGTGATGCATAGCACGAATGTTGTCGCTACCGCGCGACCGTTTGACCTTCGGCCGCTGCTGCATTGCGCTACTGCTGTACCTCTTCTGACGCCGCTATTCACCCCCCTTTCCC
GACTGTGTCACAGGAGACTTCACGCCTTTCCAGTACCAAGACCCCAGCGGCAGCCTGATGATGCTCCCGAGCGACATCGTCCTGCTGGAAGACAAGAGCTTTAAGAAGTGAGTGCATCGT
ACAGTTGGCGCGCGCGATTCAAAAGCAAAACTTCAAGAAATTGAGGCTCAGATTTGACGATAGCCAAGAAAATCGAACACACCTCAGCCGTGCATGCTACATTAAAGTCTACATAATGAC
CTATGCTTGGCTTGACGTTGATGACGAGAAAAGAAGTTGAGCCTCGACCACAAATTGACGGTTCTTCAGCGCAGGCGCTAAGCTAACTGTATGGGTGTTGACCGGCCTTCTACAGTAGTG
TCAGGCCGTGAGCAACACTGTAGAATAGCGCCAAGGCGATCTTCTCATGTCTTACCATCGTGTATGGATTGCTGTACTGCTGCCGTTGCAAGTAGGACACGAAGCTTGCAAGGACAAAAG
AGACGGTAGTATTATGTGCTGCCTCGCGCTCTTCAGGCATGTGGGAATGTATTTGGGTGCTTTTTTTCGTTTTCGCTCTCGATGGGACTGAGAGTTGGAAAGTGGGCGTTAAACATGTAG
GTATATCCTGCACTCAGCAGGGACTCCAGTTGCAATTAACACAGAACCTCGGACTTTAGTTGGCAGCAGTTGTAAACGACGGTAGGACTGACGGGTTGGAGGCATGTTTGGCATGAGGCT
TTTGGACATGGCCGCTGATGGATGACGCAGAACACTTTTCGCTCCTCGCTGTGGGGATATTTCTGTCGCATTGTTCGCTGGTACGTCAGACAGACGGACCCGTGCTACTTGTGCTCGAGT
TTAAGCGCATGGTTGGGGGCATTGGTAGTGCTCGTGATGAAAGTATTCGTCGTTCAGTCCATGTGATTCTTCTCGGAACTAATTGTGACGTCACGTGTCTGCATTTTGTTCTTGCGTGTT
TTTGTTTTTTTTTCTTGTGAAAATTTTCCTCCAGGTGTACGTCGACATGTACGCGGACAACGACAAGCTGTTCTTCGAAGACTTCTCCAAGGCCTTCGCCACCTTGCTCGAGCTAGGCAC
CAAGGATCTTGTTGAGGAATCCGCCTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAGCTGACCGTGGCAATGGTTGCGGCCCTGTCCGCACGCGAATCCCTGGCGTTCGTGCCGTCTTTCAACGCTGTAAGATCCACGTCAAGTACGGCCGCTGCTCAGGGCAACATGTGC
ACGGTGCGCATGGCAGCGGGCATGGACCAGGGAGCAAGCGAGATGAGCTCGGTCCCGATGGGCCGCAAGCAGATGCTGCAGTCCGCTGCTGCTGCCGCGTTTGGGGCGGCCTTTGTCTCG
GCGAACCCGTCCCAATCCTTCGCCGACAGTTCGGTCGACTACAAGAAG
GTCCGGGCGGATATCGAGGGCATCATGGACAAGGATGGCAGCAAGGGACCCACTCTAGTCAGGCTGGCGTGG
CACTCTTCCGGAACTTACGACAAGATCTCTAAGACGGGAGGCTCCCAGGGTGGCACCATGCGTTTCTCGCAGGAGCTCGCGGACGGCGCCAACGCTGGCCTCAACAACGCCGTGGG
GTGG
TTGGAGCCCATCAAGAAGAAGTACCCCTCGATCTCCTACGGAGATCTGTACACGCTGGCAGGGGTTACCGCGATTGAGAAGATGGGTGGCCCTACCATCAA
ATGGAGGTCAGGCCGCAAG
GACGATGATGTAGCAGCTGTGCCTCCCGGAGGCCGCCTCCCGGCTGCAGACAAGGGAAACCCCATGGCCACCGCTAAGGGGCTGCGGGACGTCTTCTACCGCATGGGCTTCAACGATAGG
GAGATCGTGGCCTTGTCCGGCGCACACGCCCTCGGAAG
GTGCCACACTGACGCCTCCGGCTACGACGGTCCGTGGACGCCCACCCCCAACCTCTTCACCGGAGCCACCTACTTCAAGCTC
CTCAAGTCCATCTCGTGGTCTGAACGCAAG
GACTTCACGCCTTTCCAGTACCAAGACCCCAGCGGCAGCCTGATGATGCTCCCGAGCGACATCGTCCTGCTGGAAGACAAGAGCTTTAAG
AA
GTACGTCGACATGTACGCGGACAACGACAAGCTGTTCTTCGAAGACTTCTCCAAGGCCTTCGCCACCTTGCTCGAGCTAGGCACCAAGGATCTTGTTGAGGAATCCGCCTGA

Retrieve as FASTA