Entry information : EsilCcP02(Esi_0095_0043)
Entry ID 13387
Creation 2014-11-19 (Bruno Savelli)
Last sequence changes 2015-08-05 (Christophe Dunand)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2021-01-29 (Christophe Dunand)
Peroxidase information: EsilCcP02(Esi_0095_0043)
Name EsilCcP02(Esi_0095_0043)
Class Cytochrome C peroxidase    [Orthogroup: CcP004]
Taxonomy Eukaryota Phaeophyceae Ectocarpaceae Ectocarpus
Organism Ectocarpus siliculosus    [TaxId: 2880 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EsilCcP02
start..stop
S start..stop
PfasCcP02 515 0 79..348 1..270
CsinCcP01 510 0 79..348 1..270
PlaCcP01 498 1.38e-179 79..347 1..269
DvirCcP02 498 1.39e-179 79..348 1..270
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '13387' 'complement(join(225366..225538,225878..225960,226602..226707,227175..227321,228269..228412,229975..230077,230418..230525,231121..231255,234422..234541))' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 234422..234541 118 N° 2 231121..231255 133 N° 3 230418..230525 106 N° 4 229975..230077 101
N° 5 228269..228412 142 N° 6 227175..227321 145 N° 7 226602..226707 104 N° 8 225878..225960 81
N° 9 225366..225538 171  
complement(join(225366..225538,225878..225960,226602..226707,227175..227321,2282 69..228412,229975..230077,230418..230525,231121..231255,234422..234541))


exon

Literature and cross-references EsilCcP02(Esi_0095_0043)
Literature Cock,J.M. et al., The Ectocarpus genome and the independent evolution of multicellularity in brown algae. Nature 465 (7298), 617-621 (2010)
Protein ref. UniProtKB:   D8LU51
DNA ref. GenBank:   FN649191.1 (234541..225366)
EST ref. GenBank:   FP290278.1 [5' end]  FP255329.1 [3' end]
Protein sequence: EsilCcP02(Esi_0095_0043)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   372
PWM (Da):   %s   39082.19  
PI (pH):   %s   4.99
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MNSAMNATRRALIARSAAAVSSRPAARVAALSTASISPHKADSKVASAAAAAAAAAAAVAAVVYSSEDSQVQAAAPPVDYAAIKKDLEAMMEAEDASREDGTSIAGTLVRLAWHASGTYS
K
ADGTGGSNGACMRMSPEKDWGANAGLDVARDFVVGLKAVYPEASYADIWTLAGATAISYMGGPEITWYPGRTDSDKPTTVPDGRLPDADKGTIGGTIQHIRDIFGRMGFTDREMVALIG
AHAVGRCHTEAS
GYWGPWTNAESTFSNEYFRLLLEEKWTIKTTHNGKKWTGPEQFEDPSGQLMMLHSDMALVWDDFRKVVEEYTADEELFFKDFAAAFAKLISLGTPSQSAAGGGGGGLL
DSFLAMIGLGK

Retrieve as FASTA  
Remarks Complete sequence from genomic (8 introns) and 8 ESTs.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAACTCCGCAATGAACGCCACTCGTAGGGCCCTCATCGCACGGTCGGCCGCGGCCGTCTCGTCCCGCCCGGCTGCTCGCGTCGCGGCGCTGAGCACGGCCTCGATCTCCCCTCACAAG
GTGAGACAAGCGCAGTTGGGAATAGTTGGGAAAGCACACCTGTCGCAGCGATTTTCTCCTACACTCTGCTGCGTGCATGTCACTGAAAGTAGCGGCAGCTGCGCACACCAATGAGTGGAG
AGATCTGCGCTGCAACGATCCCCCTGCCGTCGAACTCGTTCTCTGTCCACTGTTCTCTCTGCGTACGCGCTAACCCGTCATCTGAGCAGGTAGTAAGTCACCACAGCAGGTAGGATCGCT
CTCTCGTTGCCCAAAAAGCATCTCTCAATCCTCGCTTCCCCCAAAGGCAGCGAGCGTTCGTTGATTGTCTCGTGTGCCCCAAGCAGTACTCGTAAGTACAAGCACAGACGAAGTCTCGGA
TTCTCGAGCAGCGCATAACAACGTTGTTCAAGGTAACCGTACGCAGATAAGAACGCCTTTATCCTTGGGCTTTGCTCGTGGGCGTGGTGCGACGGCTATGTACCGCCCGAGTCAGAGCCC
CAGGGATCGACCGAGATAGAGCAGGTCGTTCGGATGTTCCTGCGAGCATGTGATGTCTGGTTGCTCGGTTGCTATGCATGCATGTGTCACCGCTCTCTCTCTCTCTCTCTCTCTCTCTCT
CTCTCTCTCTCTCTCTCTCTCTCGCCTCTTCGCATATCTCACATCTAGATCATGCCTATCCTCCCTTCGTACATGCGAGCAGTGGTCGAGTGGTTGATGTAATGTCACACACACCAAACC
TCCCTTCCTCCCGCTTGAATCTTTAGTCTAGTTTTGGTCGTCAAATCCGATATGCTTCGAAGTGATGGTATGCGTCCTACCTGTACACCCCAAGAAGCCAAGAAGGTCTCTCGCTGTCAC
TTTTGACCTTAACTTCCTTGGAGTCGTTTAGAACACCTGATAGTACGTAACAAGGGTAGCAGCAGTAACCCCTCTGCGTAATATCCCGCGCACGACCTACAATATGGCTTCAAGATGCTG
CAGCCGTATCCCTTCCGCCCAATTTTCGGCGGTAGATTGCTTTGTTTTTTTCCACCACGGATCTGGAGGGTTCCGGTCTGTTGCACTCCGTGCTACATACCTCAAATGTGTCGCTGTAGG
GATTTGGAGATACTTAAGGAATAATACTGGTAAAGGAACGAGCCTCGTGTGGAAGAAGGAGATTTTTTCTCGAGTTGGCGCCTTTTGTTTTGGACGCGCCATTGTAGAAAAGTTAAAATT
AGGGAAAACGACACAACAGGGTATACCCTGGTCGAAAAGCGACACACCTGGGTACACAGTCATTAACAGCAGTAAATGCACTCATACCATTTGTCAGCGCCCAATTTCACCCCGGTTCGT
CCGAAAAGGCGCAGGGTATATACCCTGCCGTGACTACTTTTCTCAACAACTGTACCCTGTTTTCGGATATGTACCCTGACCTGACGGGAAATGAGACCCTTTCATCAATCATTTCCCCCG
CAGGAATCTTCCCAGCTGCTTTTCCCCTCCAACCATGGGATACCAAACGGCGAATCTTCGCGCCGAGTAACAACCATGGCAACGGGGCAGGAATCAGTTTCCGTCCCTGCGAAACAACAC
CAACCATCACCTCTTCCGCTCTAAATCAACAATGGCCGGGCAATACCCCAGCACAATTGTTCCGTTTGGAAACATGGACACACGCGTACAATACCCCGTGGACTACTGCTTGCTGCAGTC
TATATGCGAGATGCACGGGTCGTGCTGTGAAAGTGAGACCGATCCAGCATGGTTGACATGCATATATGCATGTATGTGCCAATGTGTGGCTCTGTGCTGGCGGCGAGCTCGCGCCCGCAG
ATAGGGTGAAGGGGAGAGGCAAGACCAGCACACACAGACACACCCTTGGCATCAATCACGCACACACGAGTCTTATCGTTACTCTAGCAGCAGGACACTGCTGTGTCGTCCAACTCAATC
ACCCTCCCTGTCGGTAGAGAGAAGAAAGAGCGCTCGCGTTGTATTTCATCGGGTCATCCCGCTGCAGCCTGACGTCTTCTTACTACATCGATTGATTGGTCGGCTTCGTTGGCTGGTAAG
CGTGACCGCTGCTGCTACAGCAGTGGTTCAAACAAGAAACACATCGCAATCGAGACACAACAGGCAACACACGCACGCACACATGCATATATATGCATGTCAACCATGCTGGATCGGTCT
CGCTTTCATAGCGTGACCCGTGCGTCTCGCATATAGACTGCAGCAAGCAGTAGTCCACGGGGTATTGTGTCCATGTTTCCAAACGGAACAATTGTGCTGGGGTATTGCCCGGCCATTGTT
GATTTAGAGCGGAAGAGGTGATGGTTGGTGTTGTTTCGCAGGGACGGAAACTGATTCCTGCCCCGTTGCCATGGTTGTTATTCGGCGCGAAGATTCGCCGTTTGGTATCCCATGGTTGGA
GGGGAAAAGCAGTTGGGAAGATTCCTGCGGGGGAAATGATTGATGAAAGGGTCTCATTTCCCGTCAGGTCAGGGTACATATCCGAAAACAGGGTACAGTTGTTGAGAAAAGTAGTCACGG
CAGGGTATATACCCTGCGCCTTTTCGGACGAACCGGGGTGAAATTGGGCGCTGACTAATGGTATGAGTGCATTTACTGCTGTTAATGACTGTGTACCCAGGTGTGTCGCTTTTCGACCAG
GGTATACCCTGTTGTGTCGTTTTACCTTAAAATTGCTCAGCATCTCGCAGCATGGAGCGATGCTGTAAAGAGGATAACAAACGCACAGCATACGTTTTGACAACAGGCGTCTGTATGGTT
TCGATCACCTGCTGCTGAATGCATGTGGTAGAAGCAAGTAAAAGCGCGGATCGCCCCATTTTGGCGCAGCCATCACACACCGCACTCGTCTCAGAACCGACGTTGATCGATGTCAAGTGC
AATGGCCCTAGCCTTACTACGCATTATTTTGTGATTGTGATTGTGATTGTGATTGTGAGCCTTTTTCCTTTTTCGGAGCGGACCTTTTTTTTCTTTTCGCCCGCAACCTTCGAGACGCGG
CTGTTTCTTACGCTGTCGGCGATGATGTGCCCCCTGCCCTCTATTTTTATAACAGCCCCCCTTGTCCTGCCTGCATCAATGGTGCTTTTTGTTTTTGCTTTTTCGAACCATCTCTCGGCC
CTGCTGCTGCTGCTGCTGTCTCTGCTGTCCTTGCGTACACCCGCAGGCGCCGATTCTAAGGTTGCCTCCGCCGCCGCTGCCGCCGCCGCTGCCGCCGCTGCCGTAGCCGCGGTGGTTTAT
TCCTCGGAAGACTCGCAAGTCCAGGCTGCCGCTCCTCCCGTCGACTACGCAGCCATCAAGAAG
GTATGGTAAATAGTTGCTTGTGTGTGTCTTCCTCAAGCTTTGTGCAACACCCGAGCC
CGTGTTCTATGGTAGACTTGGTACTTAATGTCGAGAGAGTGACCTTGCTTGCTCCAGAGAAGGAGTATCGACTATCTACGACGCTATAGAGGGTGTACTCAAGGCAGAGGATGTCCTGGT
TCCCTTCCTTGGCCCTTCCACAAGGGGGGCACATGGGAGAAACTCCAGAACCGCAGAGCTATCCCCCCCCCCCCTATCCGCCGTGTTGTTCCTGCTCTTAATCCAGTTTGATTTTGTGTA
GGAAACTGGTGTACTTGTAGGGGCCTCATCGGGGATGATAGTCTGTATCCTCCCCCCTATCTGGGGGTGGCAACCGTATCTTCTGTGTCATCCCCAACCTCCATTGGTTCGTAATTTGGG
GCTATGCGGTCCCGGATTATCTCCTGTGGGCCCCCTCGCCTTAACGGGAAAAAGGGGACTTCGGTATTCATTCTCTCATGCCGTTCGTTACCACAACCTCGGTGGCCATGAATTGTACTT
CTCTCTTTTCCCCTCACGGCACACCGCGTGTGGTATCTTGTGATGGTCGTAATCCTAGGAGACCTTGAGGCCATGATGGAGGCGGAGGATGCTTCCCGAGAGGACGGAACCTCTATCGCG
GGCACCCTGGTCAGGCTCGCCTGGCACGCCTCGGGCACCTACTCCAAG
GTATACATACATGTATGCACCTACCGGTGATGTTGACTCGCGCGGGGGAGGGGGGGGTGGATTGGCCCGTTG
AACCGTTCTCTGACGCCCCATGTGCTGACACGCCATGACGCTTTCTCCAAAGGTGTCATAATTAGTACCGCAATGTTTTAAGAAATACTGTATGAGGATGAAGATGGTAGTGAGGAGGCT
GAGGCTGTTCGAGGGTGTGGCACATGACCCCATAATCCCATGGGAAAAGAAGCTCCCCCCCCCCCCCCCCATTCTCTTGTTTGTTGAAGTTTGTCTACCTTGCATGTATGTCCGTTTCTT
CCGCGCCCTAACGTTTTTCGTGCTCAAGGCGCGGACGGAACGGGTGGATCGAACGGCGCTTGCATGCGCATGTCGCCGGAGAAGGACTGGGGAGCCAACGCGGGGCTCGATGTCGCCAGG
GATTTCGTCGTGG
GTGTGTGTGTGTGCCGGTTCTCTGATTCTTGACCCTGCAGGCGAATTCGGGCCGTTGGTGCTTGCAATGACGTGCACGTGATTGTTGTGCTGAGATGTTGCTCGCTG
TTGTCGTCGTTATTTGCCTTGATGGGATTTCGGTGGTTGTGCCGGTTGTCCTGGCATCGGAACGTGCGCTCACCTCTGTGTCCTATTTATCGTATGGTACAGCAGTACTTCCATTCCGTG
CCGACTCCCAACGCGGGCGGGGGGGTCCCATTCGTGGTCGACAGCATCCTTCCCCAACCAAGACATTATCATTGGAAGCGCCGTCCATCCTTTCATGTTTTCTGGATTTTCGGGGGGAAA
TGCGACTGTTGTCGACCTCTCGTGCAGCACGCGCGGCCACTTTTAAGAATTATCAACCTGGGAGGGAGTTAAGGAATTCAGGCTCAGAAAGAGACAAGTTTGAGAAATTGAGCGTAAGAG
CACTTGTGCTCATTCAAAAACCCTGTAGTAAATCTTTGTGTAGTAATTAGTCGCTGTTGTGCCATTTCTCGCCGCTGTTGCTCGCTAATGTTGCCAAGTCGACGCCGGTGGGCTGTTTTT
TTTTTTCGCATTTCGCGTTTACCGGGTTGGAGTCGATTTACGCTGTTGGAAACGAAGCGCGAATACCCCCTGCCCCCTTGCTCGTCTCGTTGTGAATGCTTTGAATGCCGCCACTGCTGC
TGCTGCTGCTGCGATTGTTGTTGTTGCTAAGATGCTTCCGGGGCGTGCCGATTAGGGGGTTTGACTACCAATGACGTGTATTGGACTGGTTCTTGGGTCAAAGTTTTCGTATGATATCCA
TCTACAGTAGACTGTAGTAGTTTGTCAGCGCCGTAAAACGACTCCACATGCAACTTCTTGTGCTTGCTGTCCACCTGCTGCACCGGTTGTAGGATCGCGAGGTACGTAACGTCGGATCCT
TTCGTCTCCATTGTTTCGGCTGTACAATTTGTGCTGGAATTCACTTGTGGGTCAGTGCATGCCCCCGAACTACTCAGCTATCGCCCCCTTGAGCGACATGTTGAAAGCGATACCTTTAGC
GCGCAGCTGGTGCATGAACGGAGTGAAATGACTCCCTCGTCCAGTTGTGTCGGTTTCAGGCGAAAACTCCATAAAGAAGATTATACACACGAGGAAGGTAGACCCGGCAAAGTTCGAGGA
CGATTGCTCGCCGCTTCTACCTCCGCGACGAGCAATCGTCCTCAAACTTTTGCCGGGTCTACCTTCCTCCTCTACATTATCTTCTTCATGAAGTTTTTGCCTGTAAGAACACAACAGGCG
AGGGAGTACTTTCACTCAACTCATGCACCGGCTGCGCGCTTAAGGTATCGCGTTCAACATGTCGCTCAATGGGGCGGTAGCTAAGCAGTTTGGAGCATGGCATTGACCCACAAGTACGTT
CGAGCACAAACAACGGAGCCTCGTGCGAAACCAAGAAGTTATTTTCTTGATGGATGACAAGTTTTGTTTCAATCAATCAGATCTCATTCATTCACCCGCAAGAGTGGCTTCCTGTTTCGT
TTCTTTCTTTTCCAGGGGGCTGAAGGCAGTGTACCCGGAAGCTTCGTACGCGGATATCTGGACCCTGGCGGGCGCCACGGCCATCAGCTACATGGGGGGTCCTGAGATTACCTGGTACCC
GGGAAGGACCGACTCGGACAAGCCCACAACCGTGCCTGACG
GTGAGTCCTACACTATTCTACGGTACGGTACGGTGTACGGTACGGTACGGTTCGGTACCCACTGCACTACAATACCTAC
CGTAGGGAGGCATATGGTAAGATACAAGGCCTCTCTCGGGGCGTGGGTGTCAAGCCTCCCGCGGGTGACGCAAGATGAAATGCCTGAAAGGGGGTGTGTGTGTATTTTAACGGGCAAATA
GACCATCGCTCGTAGTATTCTGTACCAAACATCGCTCACGAATTTTTGAGCCATCTTCTCAGCCTGCAAGAACTTGACAGCGAAAAGTTCATGCTTTTCTACAAATGAGGCAGATGCTGG
TTCTAGGTCAGGTGACGTGGCATGAGATATCACACTCCCTGCACCGATTTTAAAGCTACCGTATTATTCGGAGAGATAGCACCGGGGTGCGATAAAAAACCCGAGGAACAAACATTTAAA
AAAACGACCGCACCCGGTGCCGTCTCTCGGACTATTACTATTACGGTAACCTCGATTGCTCCTCAACGAACGGTATCTACAGCAGCATGTATCAAATATCAAATCAAACCGTATGTTTCC
AGAACGCTCTCGATGAAACGGTTCCAACGCACCTATTTTTGGCATCGCCGTAGACACGTATGCAGCGTTACATAGAACAACTTGAATCATTTTGTCTGCGCCCCGAGATTTCAGCCGCCT
TTCACCAGGCAAGCGCCTTGTTCATACCACCATGTTCGGGAACCCCACTGCTGTATTCCTATGTCTTCTGACCCAGTAGCCTTGGCAAGGCTTTTTGTATTCAGGAAACATGTTGGTTAA
AGCATACAATCGGGGAAGTTGGGTTATAGGGTTAAGGTAGGGAATAGGGTCTGCGTACCCCCTTCCCTGTTCTATTTCCTTATAATACTGAATTTCCCGCGAAGGCGGTCCGTCTGACCC
GCGCCTCCCCCCGTCCTGGGCCTCTCAGGCGCCGCCTCCCCGATGCCGACAAGGGCACCATCGGGGGTACGATCCAACACATCCGCGACATCTTCGGCCGCATGGGCTTCACCGACCGCG
AGATGGTGGCTCTCATTGGCGCACACGCCGTGGGGCGGTGCCACACCGAAGCGTCGG
GTAAGCTAAGCTATTCATCAGCGAGACCAATGAGTGTCATGATGAGGAAACTGAACTGAACTG
AAGAGATTTGAACACGTGCAGGGTCAAAACTGCTGCAGCTGCTGCTGTGACAACCGCTCCTGTCGAGCAAGTGCTGTAGGTAGGTCCATGGACGGTTTCTCGCACATGTGTCCGTCTTCC
GTGTTGGTTTTGGGGCTCCGTGGATGTTGCTCGCACACTTGAATGGCTTTGGGCCCCCTTCCCTTTATTTTCCTAGACGGACAGTCGTGCACAACGTGGTGACTCCCCCCCCAGTAAGGA
ACGATTGGCCATCGGTGATCGGTCCTGTGGGAACAATACTCCGTCCTCTCGAGGACGCGTGGTCAATGGTCTAACCGCTAAGGCAATGCAAAGCATAAAGAGTACGCCCCCCCCTGCCCC
ACGCTCTCGTATTTGTGATCAATGGGATGAATTGATTGGTTAAGGGGGTACTGGGGTCCGTGGACGAACGCGGAGTCGACGTTCTCGAACGAGTACTTCCGTCTGCTGTTGGAGGAAAAG
TGGACCATCAAAACCACACACAACGGAAAGAA
GTGAGTACAGATTTGGAAGCTTCAGCTACCGTGGTATGTATGCGTAGGTCTCTCATGTGTACCTGCTGTAACCAGCGGTTGGTTGCTG
TGGAGGACGGCTGCTCGATGGGTTTCGTCTTGAGTGGTGATATTTTTCTGTGGGTCTGCTGTTTTTGTACCTCATCAGATGTTCGTTTCCGTGCCTATGCCTTGAGGAGGACGAAGAGGT
TGACGCGTACGCATTTGATTAGAAGTCAGCACTATTGAAAGCGTGAACAGATCCACAACAATAACAGGAACTACCGCGGACACCTCAGCGGGGTTAGGTGACTACAGTATTAGTAGTTGG
GCCTGTGAATGCTGCAGCTGAAACCGTTTCCGTAGACACGGGGTTGTTTTTGACTCTCATGTGCTGAGCGGGAATACCCCAGCGATGCTCTTCCTTGCCGCGCCGCTGGGCAGGAACGTG
TGTGATAGTTTATACCTCACAGGATGTGCTTTTTTTGTATTTCTTCATGTAACCCAACAATCTCTAGCTATCGATAAGGGTGTTCTCATTCTATCAGCGGCGGTTTCCATGTTGGTAGAA
TATGCACCACGGTGCTTTGATGCTTGGTTTGATGTTGTCGTGCTATCGTATGGCATCGCATGGCATCGTTCAGGTGTGGACCGGGCCGGAGCAGTTCGAAGACCCCAGCGGGCAGCTTAT
GATGCTCCACTCCGACATGGCTCTCGTCTGGGACAAAG
GTACGATCGATCCATCCATCCATCTTCAAAGTTTACGTATGTTTTCTTGATTCACGTCCGTCATGCGTCGCTACGTACACCT
CAATGCCTTGACAAACGGATCGATCTATGTCCTGGTTGTTTCGCTCATGTCATACGTCGTTATGTGCGCACCTCAATGCCTTGACCAATGCATGTACAGCTGGTGCAGGCGAGTCACGTC
GTAGTTCACTACCGTGGAGTTGTTTTCGAACAAATACCCGGGATTTAGCGTTATCGAAGGTGGAGCCGCCCATGACGTAGAGACAACGACCAGGTCTCCCTTCGTTCGCTCTCCTCTGTA
CCGCCCTCTCACAACAGACACTTCCGCAAGGTGGTGGAGGAATACACCGCTGACGAGGAGTTGTTCTTCAAGGACTTTGCCGCGGCCTTCGCCAAGCTCATCTCACTCGGAACCCCGAGT
CAGTCAGCCGCCGGCGGCGGGGGCGGCGGGCTGTTGGACTCGTTCCTTGCCATGATCGGCTTGGGCAAGTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAACTCCGCAATGAACGCCACTCGTAGGGCCCTCATCGCACGGTCGGCCGCGGCCGTCTCGTCCCGCCCGGCTGCTCGCGTCGCGGCGCTGAGCACGGCCTCGATCTCCCCTCACAAG
GCCGATTCTAAGGTTGCCTCCGCCGCCGCTGCCGCCGCCGCTGCCGCCGCTGCCGTAGCCGCGGTGGTTTATTCCTCGGAAGACTCGCAAGTCCAGGCTGCCGCTCCTCCCGTCGACTAC
GCAGCCATCAAGAAG
GACCTTGAGGCCATGATGGAGGCGGAGGATGCTTCCCGAGAGGACGGAACCTCTATCGCGGGCACCCTGGTCAGGCTCGCCTGGCACGCCTCGGGCACCTACTCC
AAG
GCGGACGGAACGGGTGGATCGAACGGCGCTTGCATGCGCATGTCGCCGGAGAAGGACTGGGGAGCCAACGCGGGGCTCGATGTCGCCAGGGATTTCGTCGTGGGGCTGAAGGCAGTG
TACCCGGAAGCTTCGTACGCGGATATCTGGACCCTGGCGGGCGCCACGGCCATCAGCTACATGGGGGGTCCTGAGATTACCTGGTACCCGGGAAGGACCGACTCGGACAAGCCCACAACC
GTGCCTGACG
GCCGCCTCCCCGATGCCGACAAGGGCACCATCGGGGGTACGATCCAACACATCCGCGACATCTTCGGCCGCATGGGCTTCACCGACCGCGAGATGGTGGCTCTCATTGGC
GCACACGCCGTGGGGCGGTGCCACACCGAAGCGTCGG
GGTACTGGGGTCCGTGGACGAACGCGGAGTCGACGTTCTCGAACGAGTACTTCCGTCTGCTGTTGGAGGAAAAGTGGACCATC
AAAACCACACACAACGGAAAGAA
GTGGACCGGGCCGGAGCAGTTCGAAGACCCCAGCGGGCAGCTTATGATGCTCCACTCCGACATGGCTCTCGTCTGGGACAAAGACTTCCGCAAGGTG
GTGGAGGAATACACCGCTGACGAGGAGTTGTTCTTCAAGGACTTTGCCGCGGCCTTCGCCAAGCTCATCTCACTCGGAACCCCGAGTCAGTCAGCCGCCGGCGGCGGGGGCGGCGGGCTG
TTGGACTCGTTCCTTGCCATGATCGGCTTGGGCAAGTAA

Retrieve as FASTA