Entry information : GrPrx03 ( Gorai.007G049900)
Entry ID 13422
Creation 2015-08-11 (Christophe Dunand)
Last sequence changes 2016-02-10 (Catherine Mathe)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2016-02-10 (Christophe Dunand)
Peroxidase information: GrPrx03 ( Gorai.007G049900)
Name (synonym) GrPrx03 ( Gorai.007G049900)
Class Class III peroxidase    [Orthogroup: Prx001]
Taxonomy Eukaryota Viridiplantae Streptophyta Malvaceae Gossypium
Organism Gossypium raimondii    [TaxId: 29730 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value GrPrx03
start..stop
S start..stop
GrPrx05 619 0 1..331 1..325
GrPrx04 598 0 1..331 1..333
CclPrx35 578 0 1..330 4..330
RcPrx17 577 0 6..331 7..331
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 3513604..3513828 225 N° 2 3513235..3513426 192 N° 3 3512994..3513159 166 N° 4 3512487..3512899 413
complement(join(3512487..3512899,3512994..3513159,3513235..3513426,3513604..3513 828))


exon

Literature and cross-references GrPrx03 ( Gorai.007G049900)
DNA ref. Phytozome 12:   Chr07 (3513968..3512343)
Cluster/Prediction ref. Phytozome Gene 12:   26779853
Protein sequence: GrPrx03 ( Gorai.007G049900)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   332 (310)
PWM (Da):   %s   36472.48 (34143.2)  
PI (pH):   %s   9.07 (9.22) Peptide Signal:   %s   cut: 22 range:22-331
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MVHYIIVITLLALGLAPHCLSSKTVGGGYLYPQFYDHSCPKAQEIVRNVVAKAVAGEPRMAASLLRLHFHDCFVKGCDASILLDSSGSIISEKRSNPNRNSARGFEVIDEIKAVMEKECPHTVSCADIMALAARDSTVLTGGPSWEVPLGRRDARGASLSGSNNNIPAPNNTFQTILTKFKLQGLDIVDLVALSGSHTIGNSRCTSFRQRLYNQSGNGQPDNTLDQSYASQLRRNCPRSGGDQNLFFLDFVSPIKFDNSYFKNLLANKGLLNSDQVLFTKNGESRELVKTYAYNQELFFQQFAKSMIKMGNISPLTGYRGEIRQNCRKINA*

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGTTCATTATATCATAGTTATTACTCTTCTAGCCCTTGGCCTTGCCCCCCATTGTTTGTCTTCCAAGACAGTTGGAGGAGGATACCTTTACCCTCAGTTTTACGATCATTCATGTCCC
AAAGCTCAAGAGATTGTGAGAAACGTTGTTGCCAAAGCTGTTGCAGGGGAACCTCGTATGGCTGCTTCATTGCTTAGGCTACACTTCCACGACTGCTTTGTTAAG
GTAACTTCATCCTCG
CCAAACCAATGGCAAAGTGTTTACTACTCGACTGTCAGTGTCGAATACAAGACTAGTGTGTCTAATATGGATATATTCAATCTTTTCCAAGTTTTTCTTTGAAGGATTATATTATTATAT
ATGGTTATATAGCAGCAAAGTTTAACAATTCATTGTTTCCAGGGCTGTGATGCATCGATTTTGTTAGACAGCAGCGGGAGCATTATCAGCGAAAAGAGGTCGAATCCAAACAGGAACTCA
GCTAGAGGATTCGAAGTGATAGATGAGATCAAAGCTGTAATGGAGAAAGAGTGTCCTCATACAGTGTCATGTGCTGATATTATGGCTTTGGCTGCTAGAGATTCTACCGTTCTC
GTATGT
CGTTTTGGTTATAGTCTTGTCTTGTCATTGAAATTGACCCCGTGGTAACATGTTTTTTTGGATTTGCAGACAGGTGGGCCTAGCTGGGAAGTCCCTCTTGGAAGAAGGGATGCCAGAGGT
GCAAGCTTGAGTGGCTCTAACAACAACATTCCTGCTCCAAACAACACATTCCAAACAATTCTCACCAAGTTTAAGCTACAAGGCCTAGACATTGTTGATCTTGTTGCACTTTCTG
GTAAG
CTATATAGTTCTTTCACATTCTGCAAATAACCAAGAAAGGCAATACTCTGAAAATATATGACCAAGTTGTCCATATATATATCATGCAGGGAGCCACACAATAGGAAATTCCCGATGCAC
CAGTTTCAGGCAGAGACTATACAACCAATCAGGCAATGGACAACCAGACAACACACTTGACCAATCCTATGCTTCTCAGCTGCGCAGGAACTGTCCAAGATCAGGCGGCGACCAGAACCT
GTTTTTCTTAGATTTTGTTAGCCCCATAAAGTTCGACAACAGCTACTTCAAGAACTTATTGGCTAACAAGGGACTGTTGAACTCTGACCAAGTTTTGTTCACAAAGAATGGTGAATCAAG
GGAGTTAGTGAAGACATATGCTTATAACCAGGAACTCTTCTTTCAGCAATTCGCTAAGTCCATGATTAAGATGGGGAATATTTCACCGTTGACAGGGTATAGGGGTGAGATCAGACAGAA
TTGCAGGAAAATTAACGCTTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGTTCATTATATCATAGTTATTACTCTTCTAGCCCTTGGCCTTGCCCCCCATTGTTTGTCTTCCAAGACAGTTGGAGGAGGATACCTTTACCCTCAGTTTTACGATCATTCATGTCCC
AAAGCTCAAGAGATTGTGAGAAACGTTGTTGCCAAAGCTGTTGCAGGGGAACCTCGTATGGCTGCTTCATTGCTTAGGCTACACTTCCACGACTGCTTTGTTAAG
GGCTGTGATGCATCG
ATTTTGTTAGACAGCAGCGGGAGCATTATCAGCGAAAAGAGGTCGAATCCAAACAGGAACTCAGCTAGAGGATTCGAAGTGATAGATGAGATCAAAGCTGTAATGGAGAAAGAGTGTCCT
CATACAGTGTCATGTGCTGATATTATGGCTTTGGCTGCTAGAGATTCTACCGTTCTC
ACAGGTGGGCCTAGCTGGGAAGTCCCTCTTGGAAGAAGGGATGCCAGAGGTGCAAGCTTGAGT
GGCTCTAACAACAACATTCCTGCTCCAAACAACACATTCCAAACAATTCTCACCAAGTTTAAGCTACAAGGCCTAGACATTGTTGATCTTGTTGCACTTTCTG
GGAGCCACACAATAGGA
AATTCCCGATGCACCAGTTTCAGGCAGAGACTATACAACCAATCAGGCAATGGACAACCAGACAACACACTTGACCAATCCTATGCTTCTCAGCTGCGCAGGAACTGTCCAAGATCAGGC
GGCGACCAGAACCTGTTTTTCTTAGATTTTGTTAGCCCCATAAAGTTCGACAACAGCTACTTCAAGAACTTATTGGCTAACAAGGGACTGTTGAACTCTGACCAAGTTTTGTTCACAAAG
AATGGTGAATCAAGGGAGTTAGTGAAGACATATGCTTATAACCAGGAACTCTTCTTTCAGCAATTCGCTAAGTCCATGATTAAGATGGGGAATATTTCACCGTTGACAGGGTATAGGGGT
GAGATCAGACAGAATTGCAGGAAAATTAACGCTTAA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATTTCAATCA AAGTCTCCCT TATAAATACC CATTCCCCTC TTTGAAAGCT CTCATCATAA CAACGTGTTC TCTTCATATT TCAGCTGTTT CCACTTCAAC TATACATCTT TTTGTCTAGA  AAGTAAAAAA GGTAAACACT ATGGTTCATT ATATCATAGT TATTACTCTT CTAGCCCTTG GCCTTGCCCC CCATTGTTTG TCTTCCAAGA CAGTTGGAGG AGGATACCTT TACCCTCAGT  TTTACGATCA TTCATGTCCC AAAGCTCAAG AGATTGTGAG AAACGTTGTT GCCAAAGCTG TTGCAGGGGA ACCTCGTATG GCTGCTTCAT TGCTTAGGCT ACACTTCCAC GACTGCTTTG  TTAAGGGCTG TGATGCATCG ATTTTGTTAG ACAGCAGCGG GAGCATTATC AGCGAAAAGA GGTCGAATCC AAACAGGAAC TCAGCTAGAG GATTCGAAGT GATAGATGAG ATCAAAGCTG  TAATGGAGAA AGAGTGTCCT CATACAGTGT CATGTGCTGA TATTATGGCT TTGGCTGCTA GAGATTCTAC CGTTCTCACA GGTGGGCCTA GCTGGGAAGT CCCTCTTGGA AGAAGGGATG  CCAGAGGTGC AAGCTTGAGT GGCTCTAACA ACAACATTCC TGCTCCAAAC AACACATTCC AAACAATTCT CACCAAGTTT AAGCTACAAG GCCTAGACAT TGTTGATCTT GTTGCACTTT  CTGGGAGCCA CACAATAGGA AATTCCCGAT GCACCAGTTT CAGGCAGAGA CTATACAACC AATCAGGCAA TGGACAACCA GACAACACAC TTGACCAATC CTATGCTTCT CAGCTGCGCA  GGAACTGTCC AAGATCAGGC GGCGACCAGA ACCTGTTTTT CTTAGATTTT GTTAGCCCCA TAAAGTTCGA CAACAGCTAC TTCAAGAACT TATTGGCTAA CAAGGGACTG TTGAACTCTG  ACCAAGTTTT GTTCACAAAG AATGGTGAAT CAAGGGAGTT AGTGAAGACA TATGCTTATA ACCAGGAACT CTTCTTTCAG CAATTCGCTA AGTCCATGAT TAAGATGGGG AATATTTCAC  CGTTGACAGG GTATAGGGGT GAGATCAGAC AGAATTGCAG GAAAATTAAC GCTTAAAATC ATCAAGTGAT AATTATATGA ATAAAGTTTG TATTCCTGTT TGTCATGTTA TTTTGGTTTC 
CTTGTATTGA ATTAATTAAT AAAAGAATTT CATTTGTGTG TATTGCTGGG CCAACGATTG TCCTTTTCTT TGTTCCCTGG 

Retrieve as FASTA