Entry information : GrPrx04 ( Gorai.007G199700)
Entry ID 13423
Creation 2015-08-11 (Christophe Dunand)
Last sequence changes 2015-08-11 (Christophe Dunand)
Sequence status complete
Reviewer Achraf Jemmat
Last annotation changes 2016-02-09 (Achraf Jemmat)
Peroxidase information: GrPrx04 ( Gorai.007G199700)
Name (synonym) GrPrx04 ( Gorai.007G199700)
Class Class III peroxidase    [Orthogroup: Prx002]
Taxonomy Eukaryota Viridiplantae Streptophyta Malvaceae Gossypium
Organism Gossypium raimondii    [TaxId: 29730 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value GrPrx04
start..stop
S start..stop
GrPrx03 598 0 1..333 1..331
NnPrx50 577 0 1..334 1..332
RcPrx17 572 0 1..333 1..331
CpapPrx44 570 0 1..333 1..331
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 261..491 231 N° 2 584..775 192 N° 3 849..1014 166 N° 4 1097..1512 416
join(261..491,584..775,849..1014,1097..1512)


exon

Literature and cross-references GrPrx04 ( Gorai.007G199700)
Literature Paterson,A.H et al., Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres. Nature 492 (7429), 423-427 (2012)
Protein ref. GenBank:   XP_012491616.1 UniProtKB:   A0A0D2PCA4
DNA ref. GenBank:   NC_026935.1 (20280012..20278761) Phytozome 12:   Chr07 (20280127..20278508)
mRNA ref. GenBank:   XM_012636162.1
Cluster/Prediction ref. Phytozome Gene 12:   26779119
Protein sequence: GrPrx04 ( Gorai.007G199700)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   335 (312)
PWM (Da):   %s   36862.53 (34402.2) Transmb domain:   %s   i7-29o
PI (pH):   %s   8.6 (8.69) Peptide Signal:   %s   cut: 23 range:23-334
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAHSMGFITVLSLLAIVPLCLSGKTYGGGGYLYPQFYDHSCPKAQEIVKHSVAKAVAEDPRMAASLLRLHFHDCFVKGCDASVLLDSSGTIISEKRSNPNRDSARGFEVIDEIKAAIEKECPHTVSCADIMALAARDSTVLTGGPNWDVPLGRRDSRDASLSGSNNNIPAPNNTFQTILTKFKLQGLDIVDLVALSGSHTIGNARCTSFRQRLYNQAGNGKPDYTFDQSYAAHLRTHCPKSGGDQNLFFLDFVSPVKFDNSYFKNLLAYKGLLSSDEVLFTKNAESRELVKTYAYNQELFFQQFAKSMIKMGNISPLTGYKGEIRKYCRKVNAY*

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 7, 3 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTCATTCTATGGGCTTTATCACAGTTCTTTCTCTTCTTGCCATTGTTCCCCTTTGTTTGTCAGGCAAGACATATGGAGGAGGAGGGTACCTCTACCCTCAGTTTTACGATCATTCA
TGTCCGAAAGCTCAAGAGATTGTGAAACACTCTGTAGCTAAAGCTGTCGCGGAGGATCCTCGTATGGCTGCTTCATTGCTAAGGCTACACTTCCATGACTGCTTTGTCAAG
GTCTTGCTT
TATATATTGGCCACATCTGGAGTAACAGTTTCAGTGTATCACAAAAGTAATTAATACCTTTTAACGCTTGGTTTTTGTCACAGGGTTGTGATGCATCAGTCTTGCTAGATAGCAGTGGGA
CTATAATTAGCGAAAAGAGGTCGAACCCTAACCGTGATTCGGCTAGGGGATTCGAAGTCATAGATGAGATCAAAGCTGCAATAGAGAAAGAGTGTCCTCATACGGTATCATGTGCTGATA
TTATGGCACTGGCTGCTAGAGATTCTACTGTTCTT
GTAAGTCCTGCCCATGCTCTAATTACGCTTAGCCAAAGCATTTGCATTGAATTAACTCCTTTGGCATTTGCAGACTGGAGGACCT
AATTGGGATGTCCCTCTTGGAAGAAGGGACTCCAGAGATGCAAGCTTGAGTGGCTCTAACAACAATATCCCTGCCCCAAACAACACATTCCAAACAATTCTCACCAAGTTCAAGCTACAA
GGCCTCGACATCGTCGATCTCGTAGCACTTTCCG
GTAAACTTACTCGACTCCAAATCTTGCACTGATATGTTCTAAAGAAGGCAAAAGTCAGAGAACATGTTTTATTTTTATGCAGGGAG
CCACACAATAGGAAATGCTCGATGCACCAGCTTCAGGCAGAGGCTTTACAACCAAGCAGGCAATGGAAAACCAGACTACACATTTGACCAATCATATGCCGCACATTTGCGCACCCATTG
TCCAAAATCAGGTGGTGACCAGAACCTGTTTTTCTTGGATTTTGTGAGCCCTGTGAAGTTTGATAACAGCTACTTCAAGAACTTGTTGGCCTACAAGGGTCTGCTCAGCTCTGACGAAGT
TTTGTTCACTAAAAATGCTGAATCAAGGGAGTTGGTGAAGACATACGCTTACAACCAGGAACTGTTCTTTCAACAATTTGCCAAGTCCATGATTAAGATGGGAAATATCTCACCATTGAC
AGGCTACAAGGGTGAGATCAGAAAGTATTGCAGGAAGGTTAATGCTTATTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTCATTCTATGGGCTTTATCACAGTTCTTTCTCTTCTTGCCATTGTTCCCCTTTGTTTGTCAGGCAAGACATATGGAGGAGGAGGGTACCTCTACCCTCAGTTTTACGATCATTCA
TGTCCGAAAGCTCAAGAGATTGTGAAACACTCTGTAGCTAAAGCTGTCGCGGAGGATCCTCGTATGGCTGCTTCATTGCTAAGGCTACACTTCCATGACTGCTTTGTCAAG
GGTTGTGAT
GCATCAGTCTTGCTAGATAGCAGTGGGACTATAATTAGCGAAAAGAGGTCGAACCCTAACCGTGATTCGGCTAGGGGATTCGAAGTCATAGATGAGATCAAAGCTGCAATAGAGAAAGAG
TGTCCTCATACGGTATCATGTGCTGATATTATGGCACTGGCTGCTAGAGATTCTACTGTTCTT
ACTGGAGGACCTAATTGGGATGTCCCTCTTGGAAGAAGGGACTCCAGAGATGCAAGC
TTGAGTGGCTCTAACAACAATATCCCTGCCCCAAACAACACATTCCAAACAATTCTCACCAAGTTCAAGCTACAAGGCCTCGACATCGTCGATCTCGTAGCACTTTCCG
GGAGCCACACA
ATAGGAAATGCTCGATGCACCAGCTTCAGGCAGAGGCTTTACAACCAAGCAGGCAATGGAAAACCAGACTACACATTTGACCAATCATATGCCGCACATTTGCGCACCCATTGTCCAAAA
TCAGGTGGTGACCAGAACCTGTTTTTCTTGGATTTTGTGAGCCCTGTGAAGTTTGATAACAGCTACTTCAAGAACTTGTTGGCCTACAAGGGTCTGCTCAGCTCTGACGAAGTTTTGTTC
ACTAAAAATGCTGAATCAAGGGAGTTGGTGAAGACATACGCTTACAACCAGGAACTGTTCTTTCAACAATTTGCCAAGTCCATGATTAAGATGGGAAATATCTCACCATTGACAGGCTAC
AAGGGTGAGATCAGAAAGTATTGCAGGAAGGTTAATGCTTATTAA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATCATAACCA AGTTTTCAAC ATTCCTCTTC ACATTTCTTC AGCTGTTTCA ACTTTGGTCT AGAAAATATT TAAGTTAAAA GGCCAAAAAC AAACTAGGAA GCTAGTAGGA CCAATATGGC  TCATTCTATG GGCTTTATCA CAGTTCTTTC TCTTCTTGCC ATTGTTCCCC TTTGTTTGTC AGGCAAGACA TATGGAGGAG GAGGGTACCT CTACCCTCAG TTTTACGATC ATTCATGTCC  GAAAGCTCAA GAGATTGTGA AACACTCTGT AGCTAAAGCT GTCGCGGAGG ATCCTCGTAT GGCTGCTTCA TTGCTAAGGC TACACTTCCA TGACTGCTTT GTCAAGGGTT GTGATGCATC  AGTCTTGCTA GATAGCAGTG GGACTATAAT TAGCGAAAAG AGGTCGAACC CTAACCGTGA TTCGGCTAGG GGATTCGAAG TCATAGATGA GATCAAAGCT GCAATAGAGA AAGAGTGTCC  TCATACGGTA TCATGTGCTG ATATTATGGC ACTGGCTGCT AGAGATTCTA CTGTTCTTAC TGGAGGACCT AATTGGGATG TCCCTCTTGG AAGAAGGGAC TCCAGAGATG CAAGCTTGAG  TGGCTCTAAC AACAATATCC CTGCCCCAAA CAACACATTC CAAACAATTC TCACCAAGTT CAAGCTACAA GGCCTCGACA TCGTCGATCT CGTAGCACTT TCCGGGAGCC ACACAATAGG  AAATGCTCGA TGCACCAGCT TCAGGCAGAG GCTTTACAAC CAAGCAGGCA ATGGAAAACC AGACTACACA TTTGACCAAT CATATGCCGC ACATTTGCGC ACCCATTGTC CAAAATCAGG  TGGTGACCAG AACCTGTTTT TCTTGGATTT TGTGAGCCCT GTGAAGTTTG ATAACAGCTA CTTCAAGAAC TTGTTGGCCT ACAAGGGTCT GCTCAGCTCT GACGAAGTTT TGTTCACTAA  AAATGCTGAA TCAAGGGAGT TGGTGAAGAC ATACGCTTAC AACCAGGAAC TGTTCTTTCA ACAATTTGCC AAGTCCATGA TTAAGATGGG AAATATCTCA CCATTGACAG GCTACAAGGG  TGAGATCAGA AAGTATTGCA GGAAGGTTAA TGCTTATTAA TAGGCATTAA GAAGTGAATA AATATTATAT CGTCTCCAGT TTTATGTTAT TATTTGCTTT CCTTCTTGAT TCATGTATTG  CATGGAGTTG TCTTGATTGT TTCATCAAAC ATGAATATCT GCAGAGTAAT TCAAATTGAA AGTAAAAGGA TGAATAGAAT GAAGTCTGAT TTTTATAAGA TCATGCACAA CAATATTTTA 
GAGGATGAGC ATGCACCTAA GGACCCACAC GCAATCAGTT CATGCAATTT TGA 

Retrieve as FASTA