Entry information : GrPrx05
Entry ID 13424
Creation 2015-08-11 (Christophe Dunand)
Last sequence changes 2015-08-11 (Christophe Dunand)
Sequence status complete
Reviewer Achraf Jemmat
Last annotation changes 2016-02-09 (Achraf Jemmat)
Peroxidase information: GrPrx05
Name GrPrx05
Class Class III peroxidase    [Orthogroup: Prx002]
Taxonomy Eukaryota Viridiplantae Streptophyta Malvaceae Gossypium
Organism Gossypium raimondii    [TaxId: 29730 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value GrPrx05
start..stop
S start..stop
GrPrx03 619 0 1..325 1..331
GrPrx04 567 0 2..325 10..333
RcPrx17 553 0 5..325 8..331
CpapPrx44 549 0 5..325 8..331
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 97..303 207 N° 2 395..586 192 N° 3 663..828 166 N° 4 901..1313 413
join(97..303,395..586,663..828,901..1313)


exon

Literature and cross-references GrPrx05
Literature Paterson,A.H. et al., Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres. Nature 492 (7429), 423-427 (2012)
Protein ref. GenBank:   KJB40465.1
DNA ref. GenBank:   NC_026935.1 (4579530..4580746) Phytozome 12:   Chr07 (4579530..4580773)
mRNA ref. GenBank:   XM_012632739.1
Cluster/Prediction ref. Phytozome Gene 12:   26782836
Protein sequence: GrPrx05
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   326 (309)
PWM (Da):   %s   35962.23 (34280.2) Transmb domain:   %s   i2-24o
PI (pH):   %s   8.96 (9.08) Peptide Signal:   %s   cut: 17 range:17-325
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MVCSIIVITLLALGLASNIIGGYLYPQFYDHSCPRAQEIVRNVVAKAVAKEPRMAASLLRLHFHDCFVKGCDASILLDSGGSIISEKKSNSNRNSARGFEVMDEIKAVIEKECPHTVSCADILALAARDSTVLTGGPSWEVPLGRRDSRGASLSCSNNNVPAPNNTFQTILTKFKLQGLDIVDLVALSGSHTIGFARCTRFRERLYNQSGNGKPDNTLDQSYASQLRRNCPRSGGDQNQFFLDFVSPIKFDNSYFKNLMANKGLLNSDQVLFTKNGESRELVKTYAYNQELFFQQFAKSMIKMGNISPLTGYRGEIRQDCRKINA*

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 7, 3 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGTTTGTTCTATAATAGTCATTACTCTTCTAGCCCTTGGCCTTGCTTCAAATATAATTGGAGGATACCTGTACCCTCAGTTTTACGATCATTCATGTCCCAGAGCTCAAGAGATAGTG
AGAAACGTTGTTGCCAAAGCTGTTGCAAAGGAACCTCGTATGGCTGCTTCATTGCTTAGGCTACACTTCCACGATTGCTTTGTTAAG
GTAACTTATTCAACCTCACCAAACCAATAGCGT
AGTGTCGAATACGAGACTAGTGTGTCTAATATGGATATATTCAATTCATTGTTTTCAGGGCTGTGATGCATCGATTTTGTTAGACAGCGGCGGGAGCATTATCAGCGAAAAGAAGTCGAA
TTCAAACAGGAACTCAGCCAGAGGATTCGAAGTGATGGATGAAATCAAAGCTGTAATAGAGAAAGAGTGCCCTCATACTGTGTCATGTGCTGACATCTTGGCTCTAGCTGCTAGAGACTC
AACTGTTCTC
GTATGTTGTTTTTTATCAGAGTTTTGTCTTGTCATTGAAATTGACCCCATGGTAACATGCTTTTTTGGAATTGCAGACAGGTGGCCCTAGCTGGGAAGTCCCACTTGGAA
GAAGGGACTCCAGAGGTGCAAGCTTGAGTTGCTCTAACAACAACGTCCCTGCTCCAAACAACACATTCCAAACAATTCTCACCAAGTTTAAGCTACAAGGTCTAGACATTGTTGATCTTG
TTGCACTTTCTG
GTAAGCTATATAGTTCTTTCACATTCTGTAAATGACCAAGAAGGCAAAACTCTGAAAATATATATCATGCAGGGAGCCACACAATAGGATTTGCCCGATGCACCAGGT
TCAGGGAGAGACTTTACAACCAGTCAGGCAATGGAAAACCAGACAACACACTTGACCAATCCTATGCTTCTCAACTGCGCAGGAACTGTCCAAGATCAGGCGGCGACCAGAACCAATTTT
TCTTAGATTTTGTTAGCCCCATAAAGTTCGACAACAGCTACTTCAAGAACTTGATGGCTAACAAGGGACTGTTGAACTCTGACCAAGTTTTGTTCACAAAGAATGGTGAATCAAGGGAGT
TAGTGAAGACATATGCTTATAACCAGGAACTCTTCTTTCAGCAATTCGCTAAGTCCATGATTAAGATGGGGAATATTTCACCGTTGACAGGGTACAGGGGTGAGATCAGACAGGATTGCA
GGAAAATTAATGCTTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGTTTGTTCTATAATAGTCATTACTCTTCTAGCCCTTGGCCTTGCTTCAAATATAATTGGAGGATACCTGTACCCTCAGTTTTACGATCATTCATGTCCCAGAGCTCAAGAGATAGTG
AGAAACGTTGTTGCCAAAGCTGTTGCAAAGGAACCTCGTATGGCTGCTTCATTGCTTAGGCTACACTTCCACGATTGCTTTGTTAAG
GGCTGTGATGCATCGATTTTGTTAGACAGCGGC
GGGAGCATTATCAGCGAAAAGAAGTCGAATTCAAACAGGAACTCAGCCAGAGGATTCGAAGTGATGGATGAAATCAAAGCTGTAATAGAGAAAGAGTGCCCTCATACTGTGTCATGTGCT
GACATCTTGGCTCTAGCTGCTAGAGACTCAACTGTTCTC
ACAGGTGGCCCTAGCTGGGAAGTCCCACTTGGAAGAAGGGACTCCAGAGGTGCAAGCTTGAGTTGCTCTAACAACAACGTC
CCTGCTCCAAACAACACATTCCAAACAATTCTCACCAAGTTTAAGCTACAAGGTCTAGACATTGTTGATCTTGTTGCACTTTCTG
GGAGCCACACAATAGGATTTGCCCGATGCACCAGG
TTCAGGGAGAGACTTTACAACCAGTCAGGCAATGGAAAACCAGACAACACACTTGACCAATCCTATGCTTCTCAACTGCGCAGGAACTGTCCAAGATCAGGCGGCGACCAGAACCAATTT
TTCTTAGATTTTGTTAGCCCCATAAAGTTCGACAACAGCTACTTCAAGAACTTGATGGCTAACAAGGGACTGTTGAACTCTGACCAAGTTTTGTTCACAAAGAATGGTGAATCAAGGGAG
TTAGTGAAGACATATGCTTATAACCAGGAACTCTTCTTTCAGCAATTCGCTAAGTCCATGATTAAGATGGGGAATATTTCACCGTTGACAGGGTACAGGGGTGAGATCAGACAGGATTGC
AGGAAAATTAATGCTTAA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGTTTGTT CTATAATAGT CATTACTCTT CTAGCCCTTG GCCTTGCTTC AAATATAATT GGAGGATACC TGTACCCTCA GTTTTACGAT CATTCATGTC CCAGAGCTCA AGAGATAGTG  AGAAACGTTG TTGCCAAAGC TGTTGCAAAG GAACCTCGTA TGGCTGCTTC ATTGCTTAGG CTACACTTCC ACGATTGCTT TGTTAAGGGC TGTGATGCAT CGATTTTGTT AGACAGCGGC  GGGAGCATTA TCAGCGAAAA GAAGTCGAAT TCAAACAGGA ACTCAGCCAG AGGATTCGAA GTGATGGATG AAATCAAAGC TGTAATAGAG AAAGAGTGCC CTCATACTGT GTCATGTGCT  GACATCTTGG CTCTAGCTGC TAGAGACTCA ACTGTTCTCA CAGGTGGCCC TAGCTGGGAA GTCCCACTTG GAAGAAGGGA CTCCAGAGGT GCAAGCTTGA GTTGCTCTAA CAACAACGTC  CCTGCTCCAA ACAACACATT CCAAACAATT CTCACCAAGT TTAAGCTACA AGGTCTAGAC ATTGTTGATC TTGTTGCACT TTCTGGGAGC CACACAATAG GATTTGCCCG ATGCACCAGG  TTCAGGGAGA GACTTTACAA CCAGTCAGGC AATGGAAAAC CAGACAACAC ACTTGACCAA TCCTATGCTT CTCAACTGCG CAGGAACTGT CCAAGATCAG GCGGCGACCA GAACCAATTT  TTCTTAGATT TTGTTAGCCC CATAAAGTTC GACAACAGCT ACTTCAAGAA CTTGATGGCT AACAAGGGAC TGTTGAACTC TGACCAAGTT TTGTTCACAA AGAATGGTGA ATCAAGGGAG  TTAGTGAAGA CATATGCTTA TAACCAGGAA CTCTTCTTTC AGCAATTCGC TAAGTCCATG ATTAAGATGG GGAATATTTC ACCGTTGACA GGGTACAGGG GTGAGATCAG ACAGGATTGC 
AGGAAAATTA ATGCTTAAAA TCATGAAGTC ATACTTATAT GAATA 

Retrieve as FASTA