Entry information : SoPrx16 (SOVF_065180)
Entry ID 13425
Creation 2015-08-12 (Christophe Dunand)
Last sequence changes 2015-08-12 (Christophe Dunand)
Sequence status complete
Reviewer Achraf Jemmat
Last annotation changes 2015-11-13 (Achraf Jemmat)
Peroxidase information: SoPrx16 (SOVF_065180)
Name (synonym) SoPrx16 (SOVF_065180)
Class Class III peroxidase    [Orthogroup: Prx002]
Taxonomy Eukaryota Viridiplantae Streptophyta Amaranthaceae Spinacia
Organism Spinacia oleracea (spinach)    [TaxId: 3562 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SoPrx16
start..stop
S start..stop
BvPrx10 599 0 6..334 5..333
BvPrx51 592 0 6..334 5..333
SoPrx15 588 0 1..334 1..334
BvPrx35 585 0 1..334 1..332
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 67107..67337 231 N° 2 67894..68085 192 N° 3 68172..68337 166 N° 4 71065..71480 416
join(67107..67337,67894..68085,68172..68337,71065..71480)


exon

Literature and cross-references SoPrx16 (SOVF_065180)
DNA ref. GenBank:   KQ141077.1 (67107..71480)
Protein sequence: SoPrx16 (SOVF_065180)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   334 (311)
PWM (Da):   %s   37077.62 (34438.3) Transmb domain:   %s   i7-29o
PI (pH):   %s   8.9 (8.88) Peptide Signal:   %s   cut: 24 range:24-334
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MVKYMMSYFIVLALLAFAPICFSNKFQGGGYLYPQFYERSCPQLQQIVKSVVAQAVSRDRRMAASLLRLHFHDCFVKGCDASVLLDNSGSIISEKGSNTNRNSARGFEVIDEIKAAVEKACPRIVSCADILALAARDSTVIAGGPNWLVPVGRRDSRGASLSGSNNDIPAPNNTFNTILTKFKRQGLDLIDLVALSGAHTIGNARCVSFRQRLYNQNRNGQPDFTLDQGYASELRNQCPQSGGDQNLFFLDYATPFNFDNSYYRNILANKGLLNSDQVLLTKNYESMQLVKQYAENMELFFDHFAKSIVKMGNISPLTGMKGEIRQNCRSINYY

Retrieve as FASTA  
Remarks Complete sequence from genomic.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGTTAAGTACATGATGAGCTACTTCATTGTTCTTGCTCTTCTAGCATTTGCTCCTATATGTTTCTCTAACAAATTCCAAGGAGGAGGGTATCTCTACCCTCAGTTCTATGAACGTTCA
TGCCCACAACTCCAACAAATAGTCAAGTCTGTAGTTGCTCAGGCGGTTTCTAGGGATCGTCGTATGGCTGCTTCCTTGCTTAGGCTTCACTTTCACGACTGCTTTGTTAAG
GTATTTTAC
TCATCTGCATCAAATGTAGATCACTTTATTACAGTTTGTAAGGATATGTTCTTTTCACCTTATTCTTATTACTTATTACTATCTCCATTTCATAAAGATCTTTACGGTTATTATTTGCAT
AAATATTAAGACAAATGTAGACAAGTTGGTTGAATATAATAAAATATGGATAATGTAAGAGAAAATGAGAAATGTGTAAAAATGTGGGTGAGTATAAGAAAAAAAAATGAATAAAATAAG
AGAAAATGAGTGAAAATTTGTAAATATCGTGAAGAAAGAAGGGTAATCTAATAAATTTTCATGTCCAAAAACAGAATAAAGCAAATTGTAAAAAAACATTATGAAACAGACTAAAACGGA
AAGTGTAAAGATCATTTTGAAATGGAGGTAGTATATCATAACATACCAGAAAAAGTAAAAAACACACTCACATAAAACATTTTGATCATACCAGATTAGAGCAGATCAAACCAGACCAGA
CTAGAAAAAATCAGAACAAAGCCTTAGTCGTCCACACCAATGATCATTTTTGGTTAAATTTTGTTAGGGATGTGATGCATCAGTGCTGCTAGACAACAGTGGAAGCATAATCTCAGAAAA
GGGATCCAACACCAACAGGAACTCAGCTCGAGGGTTTGAGGTCATTGATGAAATCAAGGCCGCAGTAGAGAAAGCATGCCCGCGTATTGTCTCTTGTGCTGATATCCTTGCTTTAGCCGC
TAGAGATTCAACTGTTATT
GTAAGCATCGATTTGAGAAATACTCGTACACTAATTTATTTATTTTCATGTAGATGTTGTTGTACTAAAACGTTATTACATTGCAGGCTGGTGGACCAAAT
TGGCTCGTACCTGTAGGAAGAAGGGATTCAAGAGGAGCAAGTTTGAGTGGATCTAACAATGACATTCCTGCTCCTAACAACACATTTAACACCATTCTTACCAAGTTTAAGCGTCAAGGC
CTTGATCTTATAGACCTTGTTGCCCTCTCAG
GTTTGTTACCATCACCATAGGCAATGGAGTATGTTAGTTTAGATGAACAACACAAGAGGGGGGGTGAATTAGTGTTTGTAGATGTTGGA
TCTACTTTTTCGCGGAATTAAAAACATTAAGAGATTGCAAGAGAGATTTTAGCGTGGAAACCTCTCTACCCTAATAGAGAGGAAAAACCACGGCCCCGTAGGGACTTAAACCCTTTTACT
AATTAGGAAAATCACAGTTCCCTAAACTCAACTCCCTTATGAACAGTCCCTCAACCGTTCCTTCTCAATGATCTCTCTAGAGATCTTCTCTCTCAACTCTTCAGCTCGACTCAAGCTGAT
TCTCTCAATTACAAGGTTCACTCAAACCCCTTCCCAACTCTCAAGTATAAAAGATAGAATAACAAATAGAATCTGGAATTCTGCTGGAGCAGGAACTACGTATGTGGAACAGGAACTGAC
GGTACAGACGTGGGTTATAATGTAGATTTAACTTAAGCACGTAACACCACTAAGTCAGACAATTTTCCTAGACTTATGAATGCAGTATATATAGTGATGCATGTTATCTATTAACCCTAG
AAGATATATTTTATGTTTATCTTTTATTTAGGAATCCTAGACCTAATAGAACTCTATCATGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNAAAATACATTGAATCTAGACAGTCCTATATTATGCATAATACTAATTATAAAAGCTTAAACTCTAAACATTTAATCTTTCCTAACATGCTTATGCAAACTAAAAC
TCTTAGACTCCTACATCGTCTACAATGCACCATAATATATGATAAATGAGACCAGCTATGATATGCATTCCTAGAAGACTCCTAATGCATATATAACTATATGAAGAGTCCTAATCACAC
ACAACTATATGTACTTATGATAGGATATTATAAGAGACCTAAACTAATGCAAAGTCCTAAGTCTAATAAACAACTTATCCCAATATGGACTCTTAATTACACATGCATATAACGAACATA
TTAGGATGCAAATATGAAAGAACTATATGCACTCCTAAACTCTATTGATGCACGCATGCGTATCTCGTACAGGTGACTGGGAACAGGAACAGTCAGACAACTAGGAACTCTGTTAAACTG
TTTCTGATCTCTTTCTTGTTGTTCCTGCTGGACCATATAAAGTATCATTTCGTTCCTCCTTTGTCACTTTACTTACCACATGAAGTTTACCAATGTAAATGCTAATTTACATATAAACAA
CATGTATAACGTAGCCATCTCCGCTCTCGTCAACAATAGCTTATCATTGCTCATATCCCTTGTCTCTTGGTTTAATCATAGCCTGTTCTTCCTATGCACATCTTAGCACACATGTTAATT
AGATAATCATCATTTGTTTATAATCATCAAAACCTCACTACTCAACAGAGTATATATTGAACTTGATACTAGCACAATACATATTATTAACATTGAGATTGAATCACGTCTACATCATTC
CTCTTGTGACTCTCTCTGATTGTTAACATACACGTAAATGTACAAATTACTTCTTTCTAAAGAATAAATCATATACTTCATATCATAAGAAATTATCAATATAATGCAAATTCTTAATTA
CACATGGTGAATGTCGTAGAGGCGGATGTAAAGTTACCCTAAAATACTTAGTAAAATTTAAATAATTGTTAGTGAAAATGTTTTAAATAAAAGTTATACATTCAAAATCACTCATAATGT
ATAAAGATAACTATATAACCCTCTACATTTTACCCATAAAAATTATTTTATAATATAAAAGGTTCTTCAAAACATGTAAATATCCCTATATCCCGAAAATTTAGGTAAAACCGACCGCGA
TGTATAATAAACTTACTGTATACCTGGTGCGTACAAGACCTGTTGTCAATATACTTCATTGCACAACTGTACTTGCTTGGATGTTGAAGTTGACAAAGAGAAGTGTATTGATGTGCAGGT
GCTCACACAATAGGAAACGCAAGGTGTGTTAGCTTCAGACAAAGGTTGTACAACCAGAACAGAAACGGACAACCAGATTTCACACTTGACCAAGGATATGCTTCTGAGTTGCGCAACCAA
TGCCCGCAATCCGGTGGTGACCAAAACTTGTTCTTCTTAGACTACGCAACCCCCTTCAATTTTGACAACAGCTACTACAGAAACATATTGGCTAACAAAGGGTTGCTGAATTCTGACCAA
GTTTTGTTAACCAAGAATTATGAATCGATGCAATTAGTGAAGCAATATGCAGAAAACATGGAGTTGTTCTTTGATCATTTTGCTAAGTCGATTGTTAAGATGGGTAATATTTCACCATTG
ACAGGGATGAAAGGAGAGATTAGGCAGAATTGCAGGAGTATTAATTACTATTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGTTAAGTACATGATGAGCTACTTCATTGTTCTTGCTCTTCTAGCATTTGCTCCTATATGTTTCTCTAACAAATTCCAAGGAGGAGGGTATCTCTACCCTCAGTTCTATGAACGTTCA
TGCCCACAACTCCAACAAATAGTCAAGTCTGTAGTTGCTCAGGCGGTTTCTAGGGATCGTCGTATGGCTGCTTCCTTGCTTAGGCTTCACTTTCACGACTGCTTTGTTAAG
GGATGTGAT
GCATCAGTGCTGCTAGACAACAGTGGAAGCATAATCTCAGAAAAGGGATCCAACACCAACAGGAACTCAGCTCGAGGGTTTGAGGTCATTGATGAAATCAAGGCCGCAGTAGAGAAAGCA
TGCCCGCGTATTGTCTCTTGTGCTGATATCCTTGCTTTAGCCGCTAGAGATTCAACTGTTATT
GCTGGTGGACCAAATTGGCTCGTACCTGTAGGAAGAAGGGATTCAAGAGGAGCAAGT
TTGAGTGGATCTAACAATGACATTCCTGCTCCTAACAACACATTTAACACCATTCTTACCAAGTTTAAGCGTCAAGGCCTTGATCTTATAGACCTTGTTGCCCTCTCAG
GTGCTCACACA
ATAGGAAACGCAAGGTGTGTTAGCTTCAGACAAAGGTTGTACAACCAGAACAGAAACGGACAACCAGATTTCACACTTGACCAAGGATATGCTTCTGAGTTGCGCAACCAATGCCCGCAA
TCCGGTGGTGACCAAAACTTGTTCTTCTTAGACTACGCAACCCCCTTCAATTTTGACAACAGCTACTACAGAAACATATTGGCTAACAAAGGGTTGCTGAATTCTGACCAAGTTTTGTTA
ACCAAGAATTATGAATCGATGCAATTAGTGAAGCAATATGCAGAAAACATGGAGTTGTTCTTTGATCATTTTGCTAAGTCGATTGTTAAGATGGGTAATATTTCACCATTGACAGGGATG
AAAGGAGAGATTAGGCAGAATTGCAGGAGTATTAATTACTATTGA

Retrieve as FASTA