Entry information : StPrx73 ( PGSC0003DMG400024053 [3.4] / Peroxidase N)
Entry ID 13461
Creation 2015-09-03 (Christophe Dunand)
Last sequence changes 2015-09-03 (Christophe Dunand)
Sequence status complete
Reviewer Achraf Jemmat
Last annotation changes 2016-02-04 (Achraf Jemmat)
Peroxidase information: StPrx73 ( PGSC0003DMG400024053 [3.4] / Peroxidase N)
Name (synonym) StPrx73 ( PGSC0003DMG400024053 [3.4] / Peroxidase N)
Class Class III peroxidase    [Orthogroup: Prx024]
Taxonomy Eukaryota Viridiplantae Streptophyta Solanaceae Solanum
Organism Solanum tuberosum (Potato)    [TaxId: 4113 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value StPrx73
start..stop
S start..stop
LePrx40 647 0 1..330 1..330
NtPrx30-1B 572 0 1..330 1..329
NtPrx30-1A 569 0 1..330 1..329
LePrx59 534 0 3..330 4..330
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1..219 219 N° 2 794..982 189 N° 3 1217..1382 166 N° 4 2398..2816 419
join(1..219,794..982,1217..1382,2398..2816)


exon

Literature and cross-references StPrx73 ( PGSC0003DMG400024053 [3.4] / Peroxidase N)
Literature Xu,X. et al., Potato Genome Sequencing Consortium. Genome sequence and analysis of the tuber crop potato. Nature 475 (7355), 189-195 (2011)
Protein ref. GenBank:   XP_015168362.1
DNA ref. GenBank:   NW_006239144.1 (709952..712863)
mRNA ref. GenBank:   XM_015312876.1
Cluster/Prediction ref. Phytozome Gene 12:   24423664
Protein sequence: StPrx73 ( PGSC0003DMG400024053 [3.4] / Peroxidase N)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   330
PWM (Da):   %s   35581.81 Transmb domain:   %s   i7-29o
PI (pH):   %s   6.97
Sequence 371
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MRKPCNFTLYYSLFVTFMIMFVVVNSQLTTDFYAKTCPSVLKVVRKEVQNAIKNEMRMAASLLRLHFHDCFVNGCDGSLLLDGNSTTSEKFAAGNINSARGFEVIDNIKKAVEDACSGVVSCADILAIAARDSVLLSGGPTWKVRLGRRDGLIGNVSGANSGLPAPFHSLNTIISMFQVVGLNVTDVVSLSGAHTIGLAKCATFDNRLTNFSGSGGPDTTLDTTLVTELQNLCPSTSDGNNTAPLDRNSTDLFDNHYFKNLLNQRGLLESDQILYSSNDAIPTTKTLVETYSNSSSVFFSDFVNSMIKMGNISPLTGSNGEIRKNCRVIN

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 1, 3 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGAGGAAGCCATGCAACTTTACTTTGTATTATTCTCTATTTGTGACTTTCATGATCATGTTTGTAGTCGTAAATTCACAATTAACAACTGATTTTTATGCAAAAACATGTCCAAGTGTTC
TCAAAGTTGTTCGTAAAGAAGTCCAAAATGCAATCAAGAATGAAATGAGAATGGCAGCTTCATTGCTTCGTCTTCATTTTCATGATTGCTTTGTTAAT
GTGAGTTTTAAGGTTCTCTTTT
ATGAGCTTTACGTACGTAGCGATAATCATTTTTACGTGGAAAAGGAATTACTCCCTTCGTCTTATATGAAACACGTTTGATTTGACATAAATTAAAGTATAAGAAAAAAAGAAATATTTT
TAAAGTTAATGGTTTAAAACAAATTTTAGATATTCATGCAGTGGTTATAAATCATTTCATTAATTTTAGATATTTGTGACCTACATACTTCATACTCCCTCCTTCAAAAAAGGAAGGCAT
AGTTTGACTTGGCATCAAGTTTAAGAAAATAAAGAAGACTTTTTAATCTTGTGGTCCTAAATTAAAGTTATGTCAAATGTATCAAAGTGCTCTTTAATCTTGTCGATTTAACACATGTCA
CATGAAAAGTTGAAATTAAAATGTTTCCAAAACGGAAACGAGTCATTCACTTTTCAACAGAATACAAAGGAAAGCAGAACATTCTTTTTTTGAAACAGGGAAAATATAATTTTCTATATA
TACCGTATAATATTTTGATAAAGGATTTTCAACGGACCATCCTTCTGAAATGTTTACTATATTTAATTGTAGGGGTGTGATGGATCATTGTTGTTGGATGGTAATAGCACCACAAGTGAA
AAGTTTGCAGCAGGGAACATAAATTCTGCTAGAGGTTTTGAAGTGATAGACAATATTAAGAAAGCTGTTGAAGATGCATGCAGTGGAGTTGTTTCTTGTGCTGATATACTTGCTATTGCT
GCTAGAGATTCTGTCCTATTA
GTATGCTCCTTTTATTTATTCCTTTCGTTTCAATTTTTTTGTCTTAATTACTTTTTTTCTAAAAATTCTTTAGTTTCAATTTTTCACCTGATATATTTA
AGACCAATATTTTGATACTTTCTAAGTATCACTATACAAAATTCAAAAGTCTTGTTTAATTATTTTTTAAAACTTTATGTCAAGTCGAAGTCGAAGTCAAACAAATAATATTATTATGTT
TTTATTAATATATAGAGTGGAGGACCAACATGGAAAGTGAGATTGGGAAGAAGGGATGGATTAATTGGTAATGTATCAGGAGCAAATAGTGGACTTCCAGCTCCTTTTCACTCTCTCAAT
ACTATCATTTCCATGTTCCAAGTTGTTGGACTCAATGTTACTGATGTTGTCAGCTTATCAG
GTACTAATATAAGTTTTCAATTTATGTAACATTCTTTTTTTTTTATGTGGAAATTAAAA
ATTTATGCAAAAATTTATGTCTTATTTTATACTATCAGTTTCAAAAGTATTTTTTGAAGTTCATGTTTAATCAAATACCATCTCATAAATGTGTTTGTGTACATCTTGAATCTAACGTAT
TTATACTATATATTTATTTATTGTGTTCAGACTTTTCAAAAATATTATCGGATGCGTTTCAAACGTAATGTAATTTTAAAGGATCTGACACAGATACAGTAATATTTTTAAAAAGTCCAA
ACAATTTAACTATTTACTAAGAGTGTGAAGATTTTTTTATGCTATAGTAATTAATTAATTTATTGTATCCAATTATTTTATGCCTCATCTTTTACACTATGGTAAAATTACATAAATGTT
TTCTTGTAAAATATAGAAGTTAAACTCTATATATAATGCCATATAAAGTGTCATCATAAGAAGGGGGCAAAGCTAGGGTGCCACAAGCAAATCCCTTTCGTTAACAAATTACACTATATA
TATCAAATTCCTTTCGTTAACAAATTACACTAAATATACCAGAGGATCAAAATTATTCTTTATATATATATGGTAGATGTTTAATCTTTTTCACTTTTTCGTATGTTTACTACTCTTTTA
TACTTTTAATTGGAAAAAAGGTCTGAAATATATTCGAACTTTGACTGAAATTACTGTCACAATCCCAAATTTTGGGCAGTACCTATATATTACCCCTACAGTATTTAATAGTATATTTTA
AAGATATATCAGTGCTCAGCTGGACAAGTTGTTATTTATAATGATGCAATATTTATGATATCCACGTAGGCCTATATATATTTTTAAAATACACTATTAAATAGTGCAGGGAGGTAATAG
GTCATGCTCAAAGTTTGAAATTGTTATAGCAATTTCAATCCAAGTTTGAATATATTTCGAACCCTTTTCCCTTTTTAATTTGATACTAACTTTATTTTTCATGTGGATATATATAGGTGC
TCATACAATTGGTCTAGCAAAATGTGCAACTTTTGATAACAGATTAACAAACTTCAGTGGATCAGGTGGACCAGACACAACCCTAGACACCACCCTAGTGACTGAACTCCAAAACTTATG
CCCTTCCACAAGTGATGGAAACAACACAGCCCCACTTGACAGGAACTCCACTGACTTATTTGACAATCACTACTTCAAAAACTTGCTTAATCAAAGAGGACTTCTTGAATCTGACCAAAT
ATTGTATTCTAGTAATGATGCTATACCAACAACTAAAACATTGGTAGAAACTTATAGTAATAGTTCAAGTGTCTTTTTTAGTGACTTTGTTAATTCTATGATTAAGATGGGAAATATTAG
CCCTCTTACTGGATCTAATGGGGAGATTAGAAAGAATTGTAGGGTAATTAATTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGAGGAAGCCATGCAACTTTACTTTGTATTATTCTCTATTTGTGACTTTCATGATCATGTTTGTAGTCGTAAATTCACAATTAACAACTGATTTTTATGCAAAAACATGTCCAAGTGTTC
TCAAAGTTGTTCGTAAAGAAGTCCAAAATGCAATCAAGAATGAAATGAGAATGGCAGCTTCATTGCTTCGTCTTCATTTTCATGATTGCTTTGTTAAT
GGGTGTGATGGATCATTGTTGT
TGGATGGTAATAGCACCACAAGTGAAAAGTTTGCAGCAGGGAACATAAATTCTGCTAGAGGTTTTGAAGTGATAGACAATATTAAGAAAGCTGTTGAAGATGCATGCAGTGGAGTTGTTT
CTTGTGCTGATATACTTGCTATTGCTGCTAGAGATTCTGTCCTATTA
AGTGGAGGACCAACATGGAAAGTGAGATTGGGAAGAAGGGATGGATTAATTGGTAATGTATCAGGAGCAAATA
GTGGACTTCCAGCTCCTTTTCACTCTCTCAATACTATCATTTCCATGTTCCAAGTTGTTGGACTCAATGTTACTGATGTTGTCAGCTTATCAG
GTGCTCATACAATTGGTCTAGCAAAAT
GTGCAACTTTTGATAACAGATTAACAAACTTCAGTGGATCAGGTGGACCAGACACAACCCTAGACACCACCCTAGTGACTGAACTCCAAAACTTATGCCCTTCCACAAGTGATGGAAACA
ACACAGCCCCACTTGACAGGAACTCCACTGACTTATTTGACAATCACTACTTCAAAAACTTGCTTAATCAAAGAGGACTTCTTGAATCTGACCAAATATTGTATTCTAGTAATGATGCTA
TACCAACAACTAAAACATTGGTAGAAACTTATAGTAATAGTTCAAGTGTCTTTTTTAGTGACTTTGTTAATTCTATGATTAAGATGGGAAATATTAGCCCTCTTACTGGATCTAATGGGG
AGATTAGAAAGAATTGTAGGGTAATTAATTAG

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GCTAAATATA TATATTTTAC TTTTGAAACC ATGAGGAAGC CATGCAACTT TACTTTGTAT TATTCTCTAT TTGTGACTTT CATGATCATG TTTGTAGTCG TAAATTCACA ATTAACAACT  GATTTTTATG CAAAAACATG TCCAAGTGTT CTCAAAGTTG TTCGTAAAGA AGTCCAAAAT GCAATCAAGA ATGAAATGAG AATGGCAGCT TCATTGCTTC GTCTTCATTT TCATGATTGC  TTTGTTAATG GGTGTGATGG ATCATTGTTG TTGGATGGTA ATAGCACCAC AAGTGAAAAG TTTGCAGCAG GGAACATAAA TTCTGCTAGA GGTTTTGAAG TGATAGACAA TATTAAGAAA  GCTGTTGAAG ATGCATGCAG TGGAGTTGTT TCTTGTGCTG ATATACTTGC TATTGCTGCT AGAGATTCTG TCCTATTAAG TGGAGGACCA ACATGGAAAG TGAGATTGGG AAGAAGGGAT  GGATTAATTG GTAATGTATC AGGAGCAAAT AGTGGACTTC CAGCTCCTTT TCACTCTCTC AATACTATCA TTTCCATGTT CCAAGTTGTT GGACTCAATG TTACTGATGT TGTCAGCTTA  TCAGGTGCTC ATACAATTGG TCTAGCAAAA TGTGCAACTT TTGATAACAG ATTAACAAAC TTCAGTGGAT CAGGTGGACC AGACACAACC CTAGACACCA CCCTAGTGAC TGAACTCCAA  AACTTATGCC CTTCCACAAG TGATGGAAAC AACACAGCCC CACTTGACAG GAACTCCACT GACTTATTTG ACAATCACTA CTTCAAAAAC TTGCTTAATC AAAGAGGACT TCTTGAATCT  GACCAAATAT TGTATTCTAG TAATGATGCT ATACCAACAA CTAAAACATT GGTAGAAACT TATAGTAATA GTTCAAGTGT CTTTTTTAGT GACTTTGTTA ATTCTATGAT TAAGATGGGA 
AATATTAGCC CTCTTACTGG ATCTAATGGG GAGATTAGAA AGAATTGTAG GGTAATTAAT TAGTCAATG 

Retrieve as FASTA