Entry information : PtroGPx02 (GPX2)
Entry ID 1351
Creation 2009-02-04 (Christophe Dunand)
Last sequence changes 2010-11-23 (Myriam Duval)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2010-12-28 (Christophe Dunand)
Peroxidase information: PtroGPx02 (GPX2)
Name (synonym) PtroGPx02 (GPX2)
Class Animal glutathione peroxidase    [Orthogroup: Gpx1004]
Taxonomy Eukaryota Metazoa Chordata Mammalia Hominidae Pan
Organism Pan troglodytes (chimpanzee)    [TaxId: 9598 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PtroGPx02
start..stop
S start..stop
HsGPx02 395 1.89e-143 1..190 1..190
HlGPx02 395 1.89e-143 1..190 1..190
PpyGPx02 393 1.17e-142 1..190 1..190
MfGPx02 390 1.41e-141 1..190 1..190
Gene structure Fichier Exons


exon

Literature and cross-references PtroGPx02 (GPX2)
Literature Chimpanzee Sequencing and Analysis Consortium. Initial sequence of the chimpanzee genome and comparison with the human genome. Nature 437 (7055), 69-87 (2005).
DNA ref. GenBank:   NC_006481.2 (64414178..64410939)
mRNA ref. GenBank:   NM_001115134
Protein sequence: PtroGPx02 (GPX2)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   190
PWM (Da):   %s   21677.08  
PI (pH):   %s   7.93
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAFIAKSFYDLSAISLDGEKVDFNTFRGRAVLIENVASLUGTTTRDFTQLNELQCRFPRRLVVLGFPCNQFGHQENCQNEEILNSLKYVRPGGGYQPTFTLVQKCEVNGQNEHPVFAYLK
DKLPYPYDDPFSLMTDPKLIIWSPVRRSDVAWNFEKFLIGPEGEPFRRYSRTFPTINIEPDIKRLLKVAI

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 14, 1 intron). No EST.
DNA
Send to BLAST
CDS
Send to BLAST