Entry information : HaAPx07 (HanXRQChr08g0229951)
Entry ID 13552
Creation 2016-04-27 (Christophe Dunand)
Last sequence changes 2016-04-27 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2017-11-23 (Catherine Mathe (Scipio))
Peroxidase information: HaAPx07 (HanXRQChr08g0229951)
Name (synonym) HaAPx07 (HanXRQChr08g0229951)
Class Ascorbate peroxidase     [Orthogroup: APx001]*
Taxonomy Eukaryota Viridiplantae Streptophyta Asteraceae Helianthus
Organism Helianthus annuus (Sunflower)    [TaxId: 4232 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HaAPx07
start..stop
S start..stop
IaquAPx06 365 1e-129 1..246 1..246
HaAPx02 362 4e-128 1..246 1..246
InAPx02 360 9e-128 1..246 1..246
HpAPx01 360 2e-127 1..246 1..246
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 101030225..101030343 119 N° 2 101029980..101030154 175 N° 3 101029822..101029887 66 N° 4 101029201..101029249 49
N° 5 101029017..101029102 86 N° 6 101028772..101028851 80 N° 7 101028581..101028683 103 N° 8 101028409..101028471 63
complement(join(101028409..101028471,101028581..101028683,101028772..101028851,1 01029017..101029102,101029201..101029249,101029822..101029887,101029980..1010301 54,101030225..101030343))


exon

Literature and cross-references HaAPx07 (HanXRQChr08g0229951)
DNA ref. HanXRQ genome:   HanXRQChr08 (101030343..101028409)
Cluster/Prediction ref. HanXRQ:   HanXRQChr08g0229951
Protein sequence: HaAPx07 (HanXRQChr08g0229951)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   246
PWM (Da):   %s   26589.42  
PI (pH):   %s   4.95
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MGKIYPSLSEEHKSAVDQAKGELRAFITEKQCAPLVLRLAFHSAGTFDVNTKTGGPFGTMKLKSEQNHGPNVGLDTAVELLEPIKQKFPLVSYGDFYMAGIVAVESTGGPQITFNPGRTDLDAPPPEGRLPLPNQGPDQLRNVFVNTMGLTDQDIVALSGAHTGSTHKERSGQDGSWTSNPMVFDNSYFKELLAGEKAGLIQLTSDKALVEDPAFRPLVEKFADQNAFFQAFAESYLKLSELG*

Retrieve as FASTA  
Remarks Complete sequence from genomic. No EST
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGGAAGATCTACCCGAGCTTAAGTGAGGAGCACAAGTCGGCTGTCGATCAAGCCAAGGGTGAGCTTCGAGCCTTCATCACCGAGAAGCAATGCGCTCCTCTAGTGCTTCGACTTGCG
TAAGACGAATTGAATTCTCCTTTTTTGGTAATTTTTTATTCGTGTTTTAATGTTGTTATTGCTCTCCAGATTTCACTCGGCTGGGACTTTCGATGTGAATACGAAGACCGGAGGTCCGTT
CGGTACCATGAAGCTTAAATCGGAGCAAAACCATGGTCCTAATGTTGGGCTTGACACTGCTGTTGAATTGTTAGAGCCTATTAAACAGAAGTTCCCACTTGTTTCCTATGGTGACTTTTA
TATG
GTAACTATGATCATGATACAATATAATTATATAAATTTTTTTTTAAGTTATGTTGTGGATCAATATTAATCTACATTTATCTTGATATATAGATGGCTGGTATTGTCGCGGTTGAA
AGTACCGGAGGACCACAAATTACTTTCAACCCCGGGAGGACG
GTATGTGCTTTTCAATGTCGGTTAAACCAGAAGACTGGTTGAACCGGTATGGTTGTATTGACTGACCTGGTTTAGTGG
TTGAATCAATATTCAATGACCCCTCTCACTAGTTGGACTTGTGTTGATTAGATTTTTTTTACAATACTTTTTGTCATGCATAAATATTACTATTTGAAACAATCTAAAAAAATATTGTTG
TATATATAAGTAACAAAATTAGATACTTTCATTTGAAAATTCTCTTATTATTCTATACTTTTTTCACTCTAAAAAACATATTTTTTATTCATTTAAATATAACCAACGTAACAATATAGT
ATTCAAATTAATGTAATATATAGTTTTTTTTAAATTAGTTATGACATCATTATGTTTTGGGTCTGGTTTAACTGTTTCAACCAGTGAACCAGTATTATGGTTGGTTATATGTCTGGTTCA
GTTGGTACAATGATCGGTTTGGTTTACATAATATTATCAATGCTCTTAATTTCTATATAATATATTTAAATGTTTTATTTGCCATTATATAATATATTTTATTGTAAATTATAATTGATT
TTTCATTCTTCAAGGACCTGGATGCTCCCCCTCCAGAAGGTCGTCTTCCTCTTCCTAATCAAGGTTGGTGAAGAAAATTGACAATTTATGGAAATTAATTATGTTGAATTCTTTTAAAGT
GGCATCATTAATACTTTATATTTATATAAAATATATGTCAGGTCCTGACCAGTTGAGGAATGTGTTTGTGAACACCATGGGTCTCACTGACCAAGATATTGTTGCTCTCTCTGGTGCACA
TACATTG
GTTTGTTTTCATACACTTATACCACATGTCATTATATAATATATATTATTTAAAAGAATAAAATCCTAGATAAAAAAATATTTCGGGTCAAACCAATGAGCACAAAGGTTACA
TATTTTGATCTGTTACCCAACCTGCTTGTTGTAACATGTTTACTTGTTCTAGGGATCTACCCACAAGGAACGATCCGGACAAGATGGATCATGGACATCCAACCCGATGGTATTTGACAA
TAGTTACTTCAA
GTAAGCTTTGTTACAAATTTTTGGTCCCTTTTTTAAAACTTTACATTCTTCATTATCATTAAGTATCATTTTGTTGAACCCGCAACAGAGAACTCTTAGCTGGTGAGA
AGGCCGGGCTGATTCAGTTAACTTCCGATAAAGCACTAGTTGAAGACCCCGCTTTTCGACCTCTTGTCGAGAAATTCGCTGCA
GTAAGTACATTTTCTTGTTTATTGCAATGTAATAATG
TCACTTTTATAATTTTAATACCATAACCATAAGTGCTAACAATAATGGGCTTTGTTTTATTTACAATAACAGGATCAAAATGCTTTCTTTCAAGCCTTTGCTGAGTCCTACTTGAAGCTT
AGCGAGTTGGGGTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGGAAGATCTACCCGAGCTTAAGTGAGGAGCACAAGTCGGCTGTCGATCAAGCCAAGGGTGAGCTTCGAGCCTTCATCACCGAGAAGCAATGCGCTCCTCTAGTGCTTCGACTTGCA
TTTCACTCGGCTGGGACTTTCGATGTGAATACGAAGACCGGAGGTCCGTTCGGTACCATGAAGCTTAAATCGGAGCAAAACCATGGTCCTAATGTTGGGCTTGACACTGCTGTTGAATTG
TTAGAGCCTATTAAACAGAAGTTCCCACTTGTTTCCTATGGTGACTTTTATATG
ATGGCTGGTATTGTCGCGGTTGAAAGTACCGGAGGACCACAAATTACTTTCAACCCCGGGAGGACG
GACCTGGATGCTCCCCCTCCAGAAGGTCGTCTTCCTCTTCCTAATCAAGGTCCTGACCAGTTGAGGAATGTGTTTGTGAACACCATGGGTCTCACTGACCAAGATATTGTTGCTCTCTCT
GGTGCACATACATTG
GGATCTACCCACAAGGAACGATCCGGACAAGATGGATCATGGACATCCAACCCGATGGTATTTGACAATAGTTACTTCAAAGAACTCTTAGCTGGTGAGAAGGCC
GGGCTGATTCAGTTAACTTCCGATAAAGCACTAGTTGAAGACCCCGCTTTTCGACCTCTTGTCGAGAAATTCGCTGCA
GATCAAAATGCTTTCTTTCAAGCCTTTGCTGAGTCCTACTTG
AAGCTTAGCGAGTTGGGGTAA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGGAAGA TCTACCCGAG CTTAAGTGAG GAGCACAAGT CGGCTGTCGA TCAAGCCAAG GGTGAGCTTC GAGCCTTCAT CACCGAGAAG CAATGCGCTC CTCTAGTGCT TCGACTTGCA  TTTCACTCGG CTGGGACTTT CGATGTGAAT ACGAAGACCG GAGGTCCGTT CGGTACCATG AAGCTTAAAT CGGAGCAAAA CCATGGTCCT AATGTTGGGC TTGACACTGC TGTTGAATTG  TTAGAGCCTA TTAAACAGAA GTTCCCACTT GTTTCCTATG GTGACTTTTA TATGATGGCT GGTATTGTCG CGGTTGAAAG TACCGGAGGA CCACAAATTA CTTTCAACCC CGGGAGGACG  GACCTGGATG CTCCCCCTCC AGAAGGTCGT CTTCCTCTTC CTAATCAAGG TCCTGACCAG TTGAGGAATG TGTTTGTGAA CACCATGGGT CTCACTGACC AAGATATTGT TGCTCTCTCT  GGTGCACATA CATTGGGATC TACCCACAAG GAACGATCCG GACAAGATGG ATCATGGACA TCCAACCCGA TGGTATTTGA CAATAGTTAC TTCAAAGAAC TCTTAGCTGG TGAGAAGGCC  GGGCTGATTC AGTTAACTTC CGATAAAGCA CTAGTTGAAG ACCCCGCTTT TCGACCTCTT GTCGAGAAAT TCGCTGCAGA TCAAAATGCT TTCTTTCAAG CCTTTGCTGA GTCCTACTTG 
AAGCTTAGCG AGTTGGGGTA A 

Retrieve as FASTA