Entry information : MmulGPx04
Entry ID 1356
Creation 2009-02-04 (Christophe Dunand)
Last sequence changes 2010-11-23 (Myriam Duval)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2010-11-23 (Myriam Duval)
Peroxidase information: MmulGPx04
Name MmulGPx04
Class Animal glutathione peroxidase    [Orthogroup: Gpx1002]
Taxonomy Eukaryota Metazoa Chordata Mammalia Cercopithecidae Macaca
Organism Macaca mulatta (rhesus monkey)    [TaxId: 9544 ]
Cellular localisation N/D
Tissue types Roots
Roots nodules
Inducer Nodulation
Repressor N/D
Best BLASTp hits
Perox score E-value MmulGPx04
start..stop
S start..stop
MnemGPx04 411 2e-149 1..197 1..197
PtroGPx04 409 8e-149 1..197 1..197
HsGPx04-A 409 8e-149 1..197 1..197
PpyGPx04-A 408 2e-148 1..197 1..197
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 854755..854838 84 N° 2 855977..856071 95 N° 3 856159..856303 145 N° 4 856469..856620 152
N° 5 856973..856997 25 N° 6 857143..857202 60 N° 7 857281..857310 30  
join(854755..854838,855977..856071,856159..856303,856469..856620,856973..856997, 857143..857202,857281..857310)


exon

Literature and cross-references MmulGPx04
Literature Magness,C.L., Fellin,P.C., Thomas,M.J., Korth,M.J., Agy,M.B., Proll,S.C., Fitzgibbon,M., Scherer,C.A., Miner,D.G., Katze,M.G. and Iadonato,S.P. Analysis of the Macaca mulatta transcriptome and the sequence divergence between Macaca and human. Genome Biol. 6 (7), R60 (2005).
DNA ref. GenBank:   NC_007876.1 (854755..857310)
mRNA ref. GenBank:   NM_001118889
Protein sequence: MmulGPx04
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   197 (172)
PWM (Da):   %s   21889.97 (19373.5)  
PI (pH):   %s   8.48 (8.05) Peptide Signal:   %s   cut: 26 range:26-197
Sequence 238
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MNLGRLCRLLKPALLCGALAAPGLAGTMCASRDDWRCARSMHEFSAKDIDGHMVNLDKYRGFVCIVTNVASQUGKTEVNYTQLVDLHARYAECGLRILAFPCNQFGKQEPGSNEEIKEFAAGYNVKFDMFSKICVNGDDAHPLWKWMKIQPKGKGILGNAIKWNFTKFLIDKNGCVVKRYGPMEEPLVIEKDLPHYF

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 19, 6 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGAACCTCGGCCGCCTTTGCCGCCTGCTGAAGCCGGCGCTGCTCTGTGGGGCTCTGGCCGCGCCCGGCCTCGCCGGTACCATGGTGAGCGGGCGCCGAGGCTGTTGCCTGCCCGGTTACC
GTTGGGGCGGGCGCGCGATCCCCGTCTCCGCTCGCCGGCGCGGGGAACCCTCGGGCTCCCGTGACCTTGGTGGGGGGCGTCTGGGTGGCTCCCCCTCCCCACCCCCGGCCGGGCGCGGAC
GCGGGTGACCGCACTGCGACGCGCTCCGTGGCCCTCCAGGCCGTTGCGGGCACGCGGGCTGGGTTCGGGGAAGGGGAAGGGGCTGTTCAATGCGCGCGGGTCGGGGTCCGGGAAGGGGCT
GTCCAGGCCGTTGCGAGCGCGCGGGCTGGGGTCGGGGAAGTGGAAGGGGCTGTTCCACGCGCGCGGGTCGGGGTCGGGGAAGCGGCCGTCCAAGCCGTTGCGGGCGCGCGCGCCGGGGTC
GGGGTCCCGGCTTGCAGGGGGCGGGGTCCGGGACGGCTGGGGCGGAGCTGGGCCGTTGGGGGCCACGGGTGGGTGTCTCCGGGCCGAGCGGGGCTGCTGCGCCCGAGCGGTTGTGGGTGC
AGAGGGCTGGAAACCCCGGATCACGCGCCCCCGGGCGCCGCCCCGCCCCCGCGGCTTGGCCTAGCTTGGTGGCGTCACAGTCGCACAGTCCTGACTTCGGCCTCCGGGCCTTTGTCCCCG
GCAGCGGCGCTCGGGGTGGGGGAGCCAGGCGGGGCGGGAGACGGGCGGGTATGGGCCGCGCGGGCGCAGGCTCCCCCAGGCGCCGCAGGCAGCGGTGCCAGAGCCGGGGCAGACGGCGGC
CGCGAGCCCCTCGACGGCGGAAGGCCCCAGCGTGCAGGCGCAGGAGGGCGCGGCGCCGGCGGAAGGAGCCCTGTCCCCGCAGCTTGGGACCGGAGATCCACGAATGTCCCGAATCCCAGG
ACCCGGTGCGCGCGGGGCCCTCACACCTGCTGCTGTGGCACTTTTTGGGGTTGGAACCTTCTCTCGGTCTCCGGGTTTCCGGTAAAACGGGACCAGAGGCACAAGGAGGCGTGTGCGTTT
GAGGAGGAGGAGCGTTCAGGTTTTCAGGGCCCCAGGGCTCCGGTGTCCCCGCCACCGACCCGCTCCGCATCCCTTCCTGCCCCAGGGCCCCCGGCTCAGCCTCCCGTCCATGCTCCCTGC
TCAGCCCCCTTTGCCTTGCAGTGCGCGTCCCGGGACGACTGGCGCTGTGCGCGCTCCATGCACGAGTTTTCCGCGAAAGACATCGACGGGCACATGGTTAACCTGGACAAGTACCGGTGG
GCGCTCGCCTGCGGTGGGGCGCATGGCCGGGGCCTGGGAGGGGGCCCTGCTCTTCTGCGCTTGACCCCCGCCGACTCTTGCAGGGGGTTCGTGTGCATCGTCACCAACGTGGCCTCCCAG
TGAGGCAAGACCGAAGTGAACTACACTCAGCTCGTCGACCTGCACGCCCGATACGCTGAGTGCGGTTTGCGGATCCTGGCCTTCCCATGTAACCAGTTCGGGAAGCAG
GTGGGCGGCTGC
TGCGTTCCCGGGGCCCGCAGAGGCCGGTGGGTGGGGGTGGGCTGTGGCCTTGCAGAGGCCGATGGGTGGGGGTCAGGGTGGGCTCCGGCCTGGAGAGGGCCTCGGAGTGTGCGGGGGCCC
CCGACGCACTCAAGCACACCTTGGCCGCCACAGGAGCCAGGGAGTAACGAAGAGATCAAAGAGTTCGCCGCAGGCTACAACGTCAAATTCGATATGTTCAGCAAGATATGCGTGAACGGG
GACGATGCCCACCCGCTGTGGAAGTGGATGAAGATCCAGCCCAAGGGCAAGGGCATCCTGGGAAA
GTGCGTGACCTCTGGGGACATTACAGCTGCGGGGTTGGGGGGGCTGTGTGGGGGC
CTGCTGGGATGTGCACACCTCCCTGGGGGCAGAATGGCTCAGGGGGCGGTTGAGGTGGGGGTGCTGGGACTCTCACACTGTGTGGCCTCCTTGGGGCAGGATGGCTCCGGGGTCCATGAA
GGGCTGTGGAAGCAGCCAGGGATGCTCACACCTTTGTGGCCTCCTGGGGACAGGATGGCTCAGGGGGCTGTGGGGGGCTGCTGGGACTCTCACACTGCGTGGCCTCCTGGGGTAAGATGG
CTGGGGAGGCGTGGGGGGGCTGCTGGGGACGTTTACACCCATGTGCTTCTTTTCCAGTGCCATCAAGTGGAACTTCACCAAGGTAAGGGGGCTGTGGGGGGTAGGGGACCAGCTCCCCCC
GGCCACAGCCCTGGCCCACATGGGCAGCGGGCAGGAAGGGCAGCCTCAGCCCCTTGCAGGGGGCCACACCCACGGTGCCCCACAGTTCAGACACTGTCTCTCCACAGTTCCTCATTGACA
AGAACGGCTGCGTGGTGAAGCGGTACGGACCCATGGAGGAACCCCTG
GTAGGTCCTCTCTAGGGAGCCTGCTTGGGGCAGCGGCTCGGGAGCTAGCTGCCCTGACCCAGCTTTTCTCCCC
GACAGGTGATAGAGAAGGACCTGCCCCACTATTTC

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGAACCTCGGCCGCCTTTGCCGCCTGCTGAAGCCGGCGCTGCTCTGTGGGGCTCTGGCCGCGCCCGGCCTCGCCGGTACCATGTGCGCGTCCCGGGACGACTGGCGCTGTGCGCGCTCCA
TGCACGAGTTTTCCGCGAAAGACATCGACGGGCACATGGTTAACCTGGACAAGTACCG
GGGGTTCGTGTGCATCGTCACCAACGTGGCCTCCCAGTGAGGCAAGACCGAAGTGAACTACA
CTCAGCTCGTCGACCTGCACGCCCGATACGCTGAGTGCGGTTTGCGGATCCTGGCCTTCCCATGTAACCAGTTCGGGAAGCAG
GAGCCAGGGAGTAACGAAGAGATCAAAGAGTTCGCCG
CAGGCTACAACGTCAAATTCGATATGTTCAGCAAGATATGCGTGAACGGGGACGATGCCCACCCGCTGTGGAAGTGGATGAAGATCCAGCCCAAGGGCAAGGGCATCCTGGGAAA
TGCCA
TCAAGTGGAACTTCACCAAG
TTCCTCATTGACAAGAACGGCTGCGTGGTGAAGCGGTACGGACCCATGGAGGAACCCCTGGTGATAGAGAAGGACCTGCCCCACTATTTC

Retrieve as FASTA