Entry information : HaPrx100 (HanXRQChr13g0388971)
Entry ID 13561
Creation 2016-05-02 (Christophe Dunand)
Last sequence changes 2016-05-02 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2017-11-23 (Catherine Mathe (Scipio))
Peroxidase information: HaPrx100 (HanXRQChr13g0388971)
Name (synonym) HaPrx100 (HanXRQChr13g0388971)
Class Class III peroxidase    [Orthogroup: Prx014]
Taxonomy Eukaryota Viridiplantae Streptophyta Asteraceae Helianthus
Organism Helianthus annuus (Sunflower)    [TaxId: 4232 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HaPrx100
start..stop
S start..stop
CiPrx02 500 1e-180 1..322 1..321
EguPrx23 497 2e-179 25..322 22..319
HaPrx10 494 5e-178 1..322 1..321
EgrPrx23 493 6e-178 25..322 22..319
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 12802709..12802933 225 N° 2 12805660..12805851 192 N° 3 12805971..12806136 166 N° 4 12806602..12806987 386
join(12802709..12802933,12805660..12805851,12805971..12806136,12806602..12806987 )


exon

Literature and cross-references HaPrx100 (HanXRQChr13g0388971)
DNA ref. HanXRQ genome:   HanXRQChr13 (12802709..12806987)
Protein sequence: HaPrx100 (HanXRQChr13g0388971)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   322 (294)
PWM (Da):   %s   33831.07 (30827.7)  
PI (pH):   %s   5.23 (5.22) Peptide Signal:   %s   cut: 29 range:29-322
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASSPSFHMYSLPTCIMCLCVLIETTSGQLSANFYGSSCPNFSSIISSAVNSAVSNEARMGASLLRLHFHDCFVNGCDASVLLDDSANFTGEKTAGPNNNSLRGFDVIDTIKSQLENSCPGVVSCADMLAAAARDSVVALGGPSWNLTFGRRDSTTASLSAANSNIPAPTLNLSGLITSFSNQGFTTNEMVALSGSHTIGQARCTVFRARIYNETNINSSLATSLRANCPSSGGDNNLSPLDVVSPTSFDNAYFSNLLNQNGLLHSDQELFNNGSTDAQVRTYSSNAATFSTDFANAMVKMSNLNPLTGSSGEVRTNCRRTN

Retrieve as FASTA  
Remarks
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTCTTCGCCATCTTTTCACATGTATAGCCTACCAACATGCATAATGTGTTTATGTGTGTTAATTGAGACAACTTCAGGTCAACTTTCAGCCAACTTTTATGGTAGCTCATGCCCT
AATTTTAGCTCCATCATATCAAGTGCTGTGAACTCCGCGGTCTCAAATGAAGCTCGAATGGGAGCTTCTTTACTTCGTCTACATTTCCATGATTGCTTTGTTAAC
GCAAGTCTTCAATCA
CTATCTCTCCTTTGTTTCTTATGGGTTAATATTCTATAGTTTATTAAACACCTAAACGAGCTAATGTTTCAAAGAAACAAATTGCTTTTAAATCCATATCAATAATAAGTTTGTTTATAA
CGTTTACTAAAGTTTTCTAGTTACTTAAATATATGTTCAAATTCTGTTGCTTTCTAATTTATTAAAAAAACCCTTAATGTCATCTATGATATTTTATTTTAAATTTTGTTATCTTTCATG
TTATGTTGACTTTAAAGCAGAAGCTTACGCGGGTTTAGTTGTTGACATAGTCGGAGCAACAAAAGTCGTTTTCATAAATCACAATCTGTATTTTACGTCCGATTAGACACGTGGAGACTT
TTTCAAAACTTTGTCGGAGATTGATTGATTGTTAGGTTAAAGGGTGTGGTTATAAGGCTATATTTGTCGGTGATTGATTGATTGTTAGGTTATAGGGTGTGGTAGGGGTGAGCAAGAAAA
CCGAAATAACCGAACCGTAACCGAATAACCGAAATAACCGAACCGAAAAAACCGAACCGAAACAAAAACCGACGGTTCGGTTTTAGGATTTTTAATAACCGAAAATTTCGGTTCGGTTTT
CGGATAAACTTTTTTAATAACCGAAAAAAACCGAACCGAACCGATAAGTTACAATTCATATATTTTTATGTTTAAGTTTAAATTGTTTAAGTGTTTAACCCAATGCTAGTAGAAAATGTT
AATGTTATTTTTGAATGTTAAGTGTTTATAATAAAAACATTATAACTGAAATGATTTATTATTACCTATAAGATATACCAAAATTTAAAAATTAAGTTTAATAAAAACTTTGAAGAAACA
TAAAGATAGATTAGAAGGTTAGGTTTATATAAACAATATATTAATTAAAGAGTTTAACTATAATAACTTAAATATAAGCATGTAAAAAGATTGTTATAATATAAATAATACTTTTTATTT
TTTGAATCTTACATAATTTTGTTTCAAAAACCGAAATAACCGAAAACCGAACCGAACCGACGTAAAAACCGAAAAACTGAAACCGAAAAAAACCAAAACCGAACGGTTTTTAAAACCCGA
AAACCGACATTTCGGTTTCGGTTTTGATTTTACCCAAAAACCGAACCGAACCGAACCGTGCACACCCCTAGGGTGTGGTCATAATTTTCAACATCACCATTATCTTTCATATCAGTGTCA
TGTTATCTCACTCTCATCCACCATTATATATGGCGTGGTCATCATTCAAACCACCATCCTCATTTTTTTAAAATTTATTTTGTGTAAAATATATTTAACTAATTAAGAAAAGGGGGGGTG
CATTGTTGCTATGGTTTAATTCATACGAATCATGATTGTTCCCTAAGAGGGGTGGTGTATAGTGGCGGACCTACCTTACAATAAGGGGTAGCCTCCGCTATCCCTTAACGGTCCGACAGT
AGTGTAAATTTTCGAAAAAATTGACATTTTTTTGACGTTTTTTCAATTTCGTTACCTTTTTTTTTTAAAAAGGATTTTCCAGATCCGCCAATGGTGGTGTAGCACATTATCCACCATCCT
AGGTGACAATCCATGACTCATCCCATGCCCCCATACCACTTAGCCAAACCCTTATGACCCGCCACATCATCGCCATGTCACAAACCTCTAATCAACCATCCAAAACCCCTACCCTAAAGG
TGTGGTCATGACCCAAACCACAAAACATTCAAATCTTGGAAAACAAAAAAAGTGGACCGTGATGGCCGTGGTTTAATCCACGCGAACCATGGTGGATGAATAGAGGGTATAACAATCCAT
TAATAATCCTATGTGACGATTGATGACCTAACCCATACCCCCACACCATTTAGCCTTATATAAATTAAGACCCAAATCATCACCCCATACCCCACAACCTGATAGTTTAACACAAGTGCA
TGACTCTAGTAGAGAACCAATTAATTTAAACATTGAATTAAGGCTCAATAGTTTGGCAACCTGTCTATGGCTATACGTTCAGTTGTGCGACCTCTCAACACATTTTCTCTTATAATATAA
TAGCTCGTTAATTCGAACATATAAACAGTACTTATGCTAGTTTATCTAAAGTGAATTTCAACCCTTTTTTCCTTTATCTAGTTGGTTGGTATACGAGTGTGTTAAGTGTAAATAATTTTC
GTATATTTTTTCTCCCTCACACTATTAACTTTGTTGTCGTAGGTGTAGTTACAAATCTATAACTAATTAATAATAAATAAGTAACTGGTTCGCTACATGTAATAATTATGTGAGCCGAAC
TTTTTATATAGTTACTGAATATTCATTAGTTACTTGGTTATGATTTTAAGACGGAATATCATCAAATGCCAGAAACTAAGTAAACGTTGTCAGCCCAGTGGCCACCGACCCCCACTTTAA
ACCGGCTCGAGGATCCATAGAGGTCACGGGTTTGAAACCTGGTAACCCTAGGCTCTTCAGTTCCCCTCGAGTTGGCAGGGGTTCTCCGCCAGGCAGCGTTGTCAGGTCGCTGGCTTGGGA
AGTGGGATCACTTCTGTGGTCGAGGGTACCGTGCATCTACCCTTTTTTTTCTATATGATTTTAAGTAACCTTATTTTTTTCAATCTGATTACGTAATACATACCATGATCCTGAATTGAA
TATGAGCAGGTTAACTTATTGAGTTGTTTTGTTTTATATCAATTATCTTATTATTTTGGAATCATTTGTAGGGTTGTGATGCATCAGTGCTACTTGATGACAGTGCAAATTTCACAGGAG
AAAAAACAGCTGGACCTAATAATAATTCATTGAGAGGATTTGATGTTATTGACACCATCAAATCTCAACTAGAGAATTCATGCCCAGGAGTCGTCTCGTGTGCCGATATGTTAGCAGCCG
CTGCACGTGATTCCGTTGTAGCA
GTAAGAGACATAAAAATTTCTTCTTAGTTTTGCAGCATTTATAATATTTTACACCATTATATATAATACAGTTATTATCAACTTGGGTGAATAGTGA
TTTACTATGGTTTTGTTTTCAGCTCGGCGGGCCAAGTTGGAACCTGACGTTTGGGAGGAGGGACTCTACAACCGCTAGTTTAAGTGCCGCAAATTCCAACATTCCAGCACCTACTTTGAA
CCTTAGTGGTCTCATTACATCCTTTTCAAACCAAGGATTTACAACTAATGAAATGGTTGCTCTATCAG
GTAATCAATCACGTAAACCTTTAAAAAGCGTTCTGAGCGAGTTATTTCAACT
CTACACTTTTTTTCCTTTGAATCAAAATTAAAACATTAAGTTCAATTTTTGTGAGCCAACAAGTAATTAGTTTATCGGAATCCAAGTCAAAATTAGATGAATAGGGTTTTTCTTTGTTGA
CATAAGATCTAATTGTGTAAAGAATCAAAAGTGATCACAGAAAATCGAAAATCCGCCCCCTTTTCTTTATTCCTTTTTCTATATTCCTTATTGTTGATTTGATCAAGAAGCCTCTATTAA
AAAGATAAAAGATGAAATTCTTATAATTAAGCAAAAAAAAAAAAAAAATATCTCATGTGATTAGATTTGCAAGCCAAATACTTAAACAAGTATGTAAATTTTCGCGATATATCAAAAGCG
TATGAGTAATGATTTATGTCATAATTTATTTTTGTAAATGTACACCAATGTAGGATCTCATACTATTGGCCAAGCAAGGTGTACAGTGTTTCGAGCTCGCATCTACAACGAAACCAACAT
AAATTCATCACTTGCTACATCATTAAGAGCGAATTGTCCATCAAGTGGTGGTGACAATAATCTGTCTCCGTTAGATGTTGTTTCTCCCACGTCATTCGACAATGCATACTTCAGTAATTT
GTTGAACCAAAATGGTTTATTGCATTCTGATCAAGAGCTTTTTAATAATGGTTCAACTGATGCCCAAGTAAGAACATACAGCTCAAATGCGGCAACCTTCTCGACTGACTTTGCAAATGC
AATGGTCAAGATGAGTAACCTTAACCCATTGACGGGATCAAGTGGCGAAGTAAGGACCAATTGCCGAAGAACGAATTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTCTTCGCCATCTTTTCACATGTATAGCCTACCAACATGCATAATGTGTTTATGTGTGTTAATTGAGACAACTTCAGGTCAACTTTCAGCCAACTTTTATGGTAGCTCATGCCCT
AATTTTAGCTCCATCATATCAAGTGCTGTGAACTCCGCGGTCTCAAATGAAGCTCGAATGGGAGCTTCTTTACTTCGTCTACATTTCCATGATTGCTTTGTTAAC
GGTTGTGATGCATCA
GTGCTACTTGATGACAGTGCAAATTTCACAGGAGAAAAAACAGCTGGACCTAATAATAATTCATTGAGAGGATTTGATGTTATTGACACCATCAAATCTCAACTAGAGAATTCATGCCCA
GGAGTCGTCTCGTGTGCCGATATGTTAGCAGCCGCTGCACGTGATTCCGTTGTAGCA
CTCGGCGGGCCAAGTTGGAACCTGACGTTTGGGAGGAGGGACTCTACAACCGCTAGTTTAAGT
GCCGCAAATTCCAACATTCCAGCACCTACTTTGAACCTTAGTGGTCTCATTACATCCTTTTCAAACCAAGGATTTACAACTAATGAAATGGTTGCTCTATCAG
GATCTCATACTATTGGC
CAAGCAAGGTGTACAGTGTTTCGAGCTCGCATCTACAACGAAACCAACATAAATTCATCACTTGCTACATCATTAAGAGCGAATTGTCCATCAAGTGGTGGTGACAATAATCTGTCTCCG
TTAGATGTTGTTTCTCCCACGTCATTCGACAATGCATACTTCAGTAATTTGTTGAACCAAAATGGTTTATTGCATTCTGATCAAGAGCTTTTTAATAATGGTTCAACTGATGCCCAAGTA
AGAACATACAGCTCAAATGCGGCAACCTTCTCGACTGACTTTGCAAATGCAATGGTCAAGATGAGTAACCTTAACCCATTGACGGGATCAAGTGGCGAAGTAAGGACCAATTGCCGAAGA
ACGAATTGA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TTTCTTTATT ATTAAAAGGG TAACAACTTT TTACAACGTT GGTTCAAAGT GCATGTAATC AACCTCTCAT TCTTATATAT AGGCTCACAA ACATCTAACT ATGCACTACC AAATTCCTTT  CTCCCACCAG CTTTAAACAG CATCTTTTTT ATCTTTCTTC AAATTGTTGA ACTCATGGCT TCTTCGCCAT CTTTTCACAT GTATAGCCTA CCAACATGCA TAATGTGTTT ATGTGTGTTA  ATTGAGACAA CTTCAGGTCA ACTTTCAGCC AACTTTTATG GTAGCTCATG CCCTAATTTT AGCTCCATCA TATCAAGTGC TGTGAACTCC GCGGTCTCAA ATGAAGCTCG AATGGGAGCT  TCTTTACTTC GTCTACATTT CCATGATTGC TTTGTTAACG GTTGTGATGC ATCAGTGCTA CTTGATGACA GTGCAAATTT CACAGGAGAA AAAACAGCTG GACCTAATAA TAATTCATTG  AGAGGATTTG ATGTTATTGA CACCATCAAA TCTCAACTAG AGAATTCATG CCCAGGAGTC GTCTCGTGTG CCGATATGTT AGCAGCCGCT GCACGTGATT CCGTTGTAGC ACTCGGCGGG  CCAAGTTGGA ACCTGACGTT TGGGAGGAGG GACTCTACAA CCGCTAGTTT AAGTGCCGCA AATTCCAACA TTCCAGCACC TACTTTGAAC CTTAGTGGTC TCATTACATC CTTTTCAAAC  CAAGGATTTA CAACTAATGA AATGGTTGCT CTATCAGGAT CTCATACTAT TGGCCAAGCA AGGTGTACAG TGTTTCGAGC TCGCATCTAC AACGAAACCA ACATAAATTC ATCACTTGCT  ACATCATTAA GAGCGAATTG TCCATCAAGT GGTGGTGACA ATAATCTGTC TCCGTTAGAT GTTGTTTCTC CCACGTCATT CGACAATGCA TACTTCAGTA ATTTGTTGAA CCAAAATGGT  TTATTGCATT CTGATCAAGA GCTTTTTAAT AATGGTTCAA CTGATGCCCA AGTAAGAACA TACAGCTCAA ATGCGGCAAC CTTCTCGACT GACTTTGCAA ATGCAATGGT CAAGATGAGT  AACCTTAACC CATTGACGGG ATCAAGTGGC GAAGTAAGGA CCAATTGCCG AAGAACGAAT TGATTACTTC TTATATTTTG GAATATGAAG TTATTTCTTA AATAAAATTC TTGAAACAAG  GATATTGTGT GTGATGAGTT GCAATTGTAC TTTGTTCTAT AGTATTATAA ATTTTTTTAG AAGTTCACTG AGTTATTCTA CTGTAATATT TTGTACCACA AATAGGATAA TAAGAACTTG 
TTTTGAATGC TTAAGAATTA AGATCATATG TTACGAGAAC A 

Retrieve as FASTA