Entry information : HaPrx107 (HanXRQChr14g0461791)
Entry ID 13568
Creation 2016-05-02 (Christophe Dunand)
Last sequence changes 2016-05-02 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2017-11-23 (Catherine Mathe (Scipio))
Peroxidase information: HaPrx107 (HanXRQChr14g0461791)
Name (synonym) HaPrx107 (HanXRQChr14g0461791)
Class Class III peroxidase    [Orthogroup: Prx032]
Taxonomy Eukaryota Viridiplantae Streptophyta Asteraceae Helianthus
Organism Helianthus annuus (Sunflower)    [TaxId: 4232 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HaPrx107
start..stop
S start..stop
ZePrx01 612 0 1..313 4..316
LsaPrx44 517 0 1..290 1..295
CroPrx34 489 1e-176 4..313 3..317
MePrx90 484 4e-174 3..313 8..323
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 171855107..171855310 204 N° 2 171855383..171855571 189 N° 3 171855681..171856229 549  
join(171855107..171855310,171855383..171855571,171855681..171856229)


exon

Literature and cross-references HaPrx107 (HanXRQChr14g0461791)
DNA ref. HanXRQ genome:   HanXRQChr14 (171855107..171856229)
Protein sequence: HaPrx107 (HanXRQChr14g0461791)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   313 (292)
PWM (Da):   %s   34234.3 (32034.1)  
PI (pH):   %s   7.99 (8.20) Peptide Signal:   %s   cut: 22 range:22-313
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAISPITAFVLILTVVPFSEAALTAHYYHQTCPQAENIIYQTVRNASIYDPKVPARLLRMFFHDCFVRGCDASLLLDSTPGNKAEKDGPPNISVRSFYVIEDAKAKIEKACPHTVSCADVLAIAARDVVAMSQGPWWPVLKGRKDGRVSKANETINLPSPFSNATTLIQSFAKRGLNVKDLVTLSGGHTLGFSHCSSFSARIDNSTDPTLNSEFAMNLKKKCPLQNKDRNAGEFLDSTSSKFDNDYYKRITMGEGVFGSDQALYGDDRTKGIVDSYAKDEKLFFKEFAASMVKLGNVGVIEDGEIRVKCSVVN*

Retrieve as FASTA  
Remarks
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTATTTCACCAATTACTGCCTTTGTTCTCATACTAACTGTAGTTCCATTTTCAGAAGCAGCACTTACTGCTCATTACTATCATCAAACATGTCCACAGGCCGAGAATATCATCTAT
CAAACAGTTCGCAATGCCTCTATTTACGACCCTAAAGTCCCAGCCCGCCTTCTTAGGATGTTCTTCCATGACTGTTTTGTTAGG
GTATGCTTTCACATAACCTATTATTAACCTTTTCGA
CTATTTCATCATGAACTAAACACGTGTTATATTTAGGGATGTGATGCATCATTGTTGCTTGACTCAACCCCGGGAAACAAAGCAGAAAAAGATGGGCCTCCAAATATCTCGGTTCGATCG
TTTTATGTAATTGAGGATGCCAAAGCAAAGATCGAAAAAGCATGCCCACACACGGTTTCTTGTGCTGACGTATTAGCAATCGCTGCTAGAGATGTAGTAGCAATG
GTACACATTAATTCT
TTTTTCTTCCTTTATATTTAGGCACATAAACCGTTTCACTCGGTTGAAGTTAAAACCATCATGTTTGATGTTCTTATATTACCATTTTCTCCAGTCTCAAGGTCCATGGTGGCCGGTGCT
TAAAGGAAGGAAAGACGGGAGAGTGTCGAAAGCTAATGAAACCATAAACCTCCCATCTCCATTTTCCAATGCCACAACACTTATTCAAAGTTTTGCTAAAAGAGGATTAAATGTCAAAGA
TTTGGTCACACTTTCAGGTGGACACACATTAGGGTTTTCACACTGTTCTTCATTTAGTGCTCGCATAGACAACTCAACTGATCCTACGCTTAATAGTGAGTTTGCTATGAACCTGAAAAA
GAAATGTCCTCTACAAAACAAAGATCGCAACGCAGGAGAGTTTTTGGATTCCACTTCTTCAAAGTTTGATAATGACTATTACAAAAGAATTACTATGGGTGAGGGCGTGTTTGGGTCGGA
CCAAGCACTGTATGGAGATGACAGGACTAAAGGGATTGTGGATTCGTATGCTAAAGATGAGAAACTGTTCTTCAAAGAATTCGCAGCTTCTATGGTCAAACTCGGAAATGTAGGTGTTAT
AGAAGATGGTGAAATCAGAGTGAAGTGTAGCGTCGTAAATTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTATTTCACCAATTACTGCCTTTGTTCTCATACTAACTGTAGTTCCATTTTCAGAAGCAGCACTTACTGCTCATTACTATCATCAAACATGTCCACAGGCCGAGAATATCATCTAT
CAAACAGTTCGCAATGCCTCTATTTACGACCCTAAAGTCCCAGCCCGCCTTCTTAGGATGTTCTTCCATGACTGTTTTGTTAGG
GGATGTGATGCATCATTGTTGCTTGACTCAACCCCG
GGAAACAAAGCAGAAAAAGATGGGCCTCCAAATATCTCGGTTCGATCGTTTTATGTAATTGAGGATGCCAAAGCAAAGATCGAAAAAGCATGCCCACACACGGTTTCTTGTGCTGACGTA
TTAGCAATCGCTGCTAGAGATGTAGTAGCAATG
TCTCAAGGTCCATGGTGGCCGGTGCTTAAAGGAAGGAAAGACGGGAGAGTGTCGAAAGCTAATGAAACCATAAACCTCCCATCTCCA
TTTTCCAATGCCACAACACTTATTCAAAGTTTTGCTAAAAGAGGATTAAATGTCAAAGATTTGGTCACACTTTCAGGTGGACACACATTAGGGTTTTCACACTGTTCTTCATTTAGTGCT
CGCATAGACAACTCAACTGATCCTACGCTTAATAGTGAGTTTGCTATGAACCTGAAAAAGAAATGTCCTCTACAAAACAAAGATCGCAACGCAGGAGAGTTTTTGGATTCCACTTCTTCA
AAGTTTGATAATGACTATTACAAAAGAATTACTATGGGTGAGGGCGTGTTTGGGTCGGACCAAGCACTGTATGGAGATGACAGGACTAAAGGGATTGTGGATTCGTATGCTAAAGATGAG
AAACTGTTCTTCAAAGAATTCGCAGCTTCTATGGTCAAACTCGGAAATGTAGGTGTTATAGAAGATGGTGAAATCAGAGTGAAGTGTAGCGTCGTAAATTGA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GGCACTACAA ATACTCCCAC AATTTCTATG GAACTCATCA TCCTCTGCCC TCTGCTTCTT CTAAAGACAG ATGGCTATTT CACCAATTAC TGCCTTTGTT CTCATACTAA CTGTAGTTCC  ATTTTCAGAA GCAGCACTTA CTGCTCATTA CTATCATCAA ACATGTCCAC AGGCCGAGAA TATCATCTAT CAAACAGTTC GCAATGCCTC TATTTACGAC CCTAAAGTCC CAGCCCGCCT  TCTTAGGATG TTCTTCCATG ACTGTTTTGT TAGGGGATGT GATGCATCAT TGTTGCTTGA CTCAACCCCG GGAAACAAAG CAGAAAAAGA TGGGCCTCCA AATATCTCGG TTCGATCGTT  TTATGTAATT GAGGATGCCA AAGCAAAGAT CGAAAAAGCA TGCCCACACA CGGTTTCTTG TGCTGACGTA TTAGCAATCG CTGCTAGAGA TGTAGTAGCA ATGTCTCAAG GTCCATGGTG  GCCGGTGCTT AAAGGAAGGA AAGACGGGAG AGTGTCGAAA GCTAATGAAA CCATAAACCT CCCATCTCCA TTTTCCAATG CCACAACACT TATTCAAAGT TTTGCTAAAA GAGGATTAAA  TGTCAAAGAT TTGGTCACAC TTTCAGGTGG ACACACATTA GGGTTTTCAC ACTGTTCTTC ATTTAGTGCT CGCATAGACA ACTCAACTGA TCCTACGCTT AATAGTGAGT TTGCTATGAA  CCTGAAAAAG AAATGTCCTC TACAAAACAA AGATCGCAAC GCAGGAGAGT TTTTGGATTC CACTTCTTCA AAGTTTGATA ATGACTATTA CAAAAGAATT ACTATGGGTG AGGGCGTGTT  TGGGTCGGAC CAAGCACTGT ATGGAGATGA CAGGACTAAA GGGATTGTGG ATTCGTATGC TAAAGATGAG AAACTGTTCT TCAAAGAATT CGCAGCTTCT ATGGTCAAAC TCGGAAATGT  AGGTGTTATA GAAGATGGTG AAATCAGAGT GAAGTGTAGC GTCGTAAATT GAGGCATGAA GAGAGAAAGG GAAGAATGGA AGAGAAAGAT AAAACTTTTA TACAAATTTT TTAAATAATT 
TGTTGTTTTC CTTTGTTGGT TTTAATAAAT GAATAAAACG GACCTATTGC CTTTTGTTTA TATCTTT 

Retrieve as FASTA