Entry information : HaPrx108 (HanXRQChr15g0479151)
Entry ID 13569
Creation 2016-05-02 (Christophe Dunand)
Last sequence changes 2016-05-02 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2017-11-23 (Catherine Mathe (Scipio))
Peroxidase information: HaPrx108 (HanXRQChr15g0479151)
Name (synonym) HaPrx108 (HanXRQChr15g0479151)
Class Class III peroxidase    [Orthogroup: Prx010]
Taxonomy Eukaryota Viridiplantae Streptophyta Asteraceae Helianthus
Organism Helianthus annuus (Sunflower)    [TaxId: 4232 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HaPrx108
start..stop
S start..stop
HaPrx123 577 0 1..324 1..324
LsaPrx31 573 0 1..324 1..325
HaPrx05 569 0 1..324 1..324
LvPrx31 568 0 1..322 1..323
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 57461629..57461826 198 N° 2 57462447..57462644 198 N° 3 57462719..57462881 163 N° 4 57463027..57463442 416
join(57461629..57461826,57462447..57462644,57462719..57462881,57463027..57463442 )


exon

Literature and cross-references HaPrx108 (HanXRQChr15g0479151)
DNA ref. HanXRQ genome:   HanXRQChr15 (57461629..57463442)
Protein sequence: HaPrx108 (HanXRQChr15g0479151)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   324 (305)
PWM (Da):   %s   35215.89 (33083.7)  
PI (pH):   %s   6.88 (6.13) Peptide Signal:   %s   cut: 20 range:20-324
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MKGFFSLFVFLVIFGSVRGDLKLGFYKSACPKAEKIVQDYVNQHIPNAPSLAAALIRMHFHDCFVRGCDGSVLLNFTSSSGNQTEKTAPPNLTVRGFDFIDRLKSLLEAECPGIVSCADIVALAARDSIVVTGGPSWKVPTGRRDGVISVASEALAEIPAPFDNITTLIQNFANKSLDIKDLVLLSGAHTIGISLCTSFSNRLYNFTGVGDQDPTLDSEYAANLKSRKCRTQNDNTTIVEMDPGSRTTFDLSYYSLLLKRRGLFESDSALTRDSNTLALINQLLQGSLQNFFSEFAMSMEKMGQIEVKTGTSGEIRKNCAVVNS

Retrieve as FASTA  
Remarks
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAAGGTTTTTTCTCGCTTTTTGTGTTTCTTGTGATTTTTGGTTCGGTTCGAGGTGATCTGAAGCTAGGGTTTTATAAGAGTGCATGCCCAAAAGCCGAAAAGATAGTACAAGATTAT
GTGAACCAACATATTCCCAATGCTCCATCGCTTGCGGCGGCTCTTATCAGAATGCATTTCCATGATTGTTTCGTTAGG
GTTAGTTCGTTCGATATTTTATCTTTTTTCATTTTGTTTTTA
GAACTTGTAGCAATGCATACATGAAATGAATGCTCGCATAAATGTGTTGCCATGTTGCAATATACAATGTAGCATTTGCGTGTGTGCATGCATTGCTTCGCGGTATAACTATCTTGTTTA
GGTTATCTAAACTTTCGTTTTACTTTGTGGATCCCGTCTTTATTTAGAACATGTAAGGCCGTAAATACACTTTATTTGTTATAAGTTATAACATGTCAAGATCCCGTCTAGTGGTGGAAC
TAGAACTTGTTAGCAGAGATCACAATGCACGTAAAAGACGATTTTACCCTTTCCAAAACTAATATTGCATGGTAAACTCCCGTCTAGTAGTGGAACTAGAACTTGGGAGCAAAGTTCAAA
ATGCACTTAAAAAGTCGATTTTCCCCTTTTAAAAACTAATTTTGCAAGGTGGATTGAATAAGAAATTTGTAATGTTTAATTTGAATGTAATACTTTGATTTCTTCTAGCATGTAAAAATC
CCGTCCAGTTGTGGAACTTGAACTTGTCAACACATGTCACAATACAAAAAAGACGATTTTACCCTTTCGAAACTAACATTGCATGGTGTTTTCAATAGGGTTGTGACGGATCCGTCCTTT
TGAATTTTACTTCAAGCTCAGGGAATCAAACAGAGAAAACAGCACCCCCAAACCTAACTGTTCGAGGGTTTGATTTCATCGATAGATTGAAGAGTTTACTCGAAGCCGAATGCCCTGGCA
TTGTTTCTTGTGCTGATATTGTTGCTCTTGCAGCTAGAGACTCCATCGTTGTCACC
GTAAGAATTTATATTTCGTTATCATAAATCCCACCCTAATATAAACATACTGATTTCTTTCGGT
TTTATTAAAGGGTGGCCCTTCATGGAAAGTACCAACGGGCCGAAGAGACGGGGTGATATCAGTTGCATCAGAGGCGTTAGCCGAAATCCCCGCTCCATTCGACAACATCACCACCCTCAT
ACAAAACTTTGCCAATAAAAGTCTTGATATAAAGGATCTTGTTTTGCTTTCAG
GTTAGTTATATTACAATACAATATGTTTGATGCATTTTGTTTGACTAAATTATATGCCTTTTATATG
AATCAACTTAATGATAAGTAAACGAGTCAAAATTGTCACCATAAATACGAAGTTTACTATATTTTGATGTTATTTTAGGTGCTCACACTATTGGAATCTCGCTTTGTACCTCATTTTCAA
ACCGTCTATACAATTTCACGGGTGTGGGAGATCAAGACCCGACACTCGATAGTGAATACGCTGCCAATCTTAAATCAAGAAAATGCAGGACACAAAACGACAATACAACAATAGTTGAGA
TGGATCCTGGGAGCCGTACCACTTTCGATCTTAGCTACTACTCGCTATTGCTAAAGCGTAGGGGATTGTTCGAGTCTGATTCGGCTCTTACTAGGGACTCAAACACGTTGGCATTAATAA
ATCAACTCCTTCAAGGATCACTTCAGAATTTCTTCAGTGAGTTTGCAATGTCCATGGAGAAAATGGGTCAGATTGAGGTGAAAACGGGTACCTCCGGTGAGATCCGAAAGAATTGTGCTG
TTGTAAACAGCTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAAGGTTTTTTCTCGCTTTTTGTGTTTCTTGTGATTTTTGGTTCGGTTCGAGGTGATCTGAAGCTAGGGTTTTATAAGAGTGCATGCCCAAAAGCCGAAAAGATAGTACAAGATTAT
GTGAACCAACATATTCCCAATGCTCCATCGCTTGCGGCGGCTCTTATCAGAATGCATTTCCATGATTGTTTCGTTAGG
GGTTGTGACGGATCCGTCCTTTTGAATTTTACTTCAAGCTCA
GGGAATCAAACAGAGAAAACAGCACCCCCAAACCTAACTGTTCGAGGGTTTGATTTCATCGATAGATTGAAGAGTTTACTCGAAGCCGAATGCCCTGGCATTGTTTCTTGTGCTGATATT
GTTGCTCTTGCAGCTAGAGACTCCATCGTTGTCACC
GGTGGCCCTTCATGGAAAGTACCAACGGGCCGAAGAGACGGGGTGATATCAGTTGCATCAGAGGCGTTAGCCGAAATCCCCGCT
CCATTCGACAACATCACCACCCTCATACAAAACTTTGCCAATAAAAGTCTTGATATAAAGGATCTTGTTTTGCTTTCAG
GTGCTCACACTATTGGAATCTCGCTTTGTACCTCATTTTCA
AACCGTCTATACAATTTCACGGGTGTGGGAGATCAAGACCCGACACTCGATAGTGAATACGCTGCCAATCTTAAATCAAGAAAATGCAGGACACAAAACGACAATACAACAATAGTTGAG
ATGGATCCTGGGAGCCGTACCACTTTCGATCTTAGCTACTACTCGCTATTGCTAAAGCGTAGGGGATTGTTCGAGTCTGATTCGGCTCTTACTAGGGACTCAAACACGTTGGCATTAATA
AATCAACTCCTTCAAGGATCACTTCAGAATTTCTTCAGTGAGTTTGCAATGTCCATGGAGAAAATGGGTCAGATTGAGGTGAAAACGGGTACCTCCGGTGAGATCCGAAAGAATTGTGCT
GTTGTAAACAGCTAA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAACAAA TCCGTGAAGA TCAACTAGTG CATGCATGCG TTTGAATCTT ATGTCACACA TGCTTATGGC CTGTGTATTA GACGTTACTT GCATACTCAT ACTCAGCCCT ATCCATTACA  AGAATCTTGA AAGAAGCGAA AAGGCGAAGA AATGAAAGGT TTTTTCTCGC TTTTTGTGTT TCTTGTGATT TTTGGTTCGG TTCGAGGTGA TCTGAAGCTA GGGTTTTATA AGAGTGCATG  CCCAAAAGCC GAAAAGATAG TACAAGATTA TGTGAACCAA CATATTCCCA ATGCTCCATC GCTTGCGGCG GCTCTTATCA GAATGCATTT CCATGATTGT TTCGTTAGGG GTTGTGACGG  ATCCGTCCTT TTGAATTTTA CTTCAAGCTC AGGGAATCAA ACAGAGAAAA CAGCACCCCC AAACCTAACT GTTCGAGGGT TTGATTTCAT CGATAGATTG AAGAGTTTAC TCGAAGCCGA  ATGCCCTGGC ATTGTTTCTT GTGCTGATAT TGTTGCTCTT GCAGCTAGAG ACTCCATCGT TGTCACCGGT GGCCCTTCAT GGAAAGTACC AACGGGCCGA AGAGACGGGG TGATATCAGT  TGCATCAGAG GCGTTAGCCG AAATCCCCGC TCCATTCGAC AACATCACCA CCCTCATACA AAACTTTGCC AATAAAAGTC TTGATATAAA GGATCTTGTT TTGCTTTCAG GTGCTCACAC  TATTGGAATC TCGCTTTGTA CCTCATTTTC AAACCGTCTA TACAATTTCA CGGGTGTGGG AGATCAAGAC CCGACACTCG ATAGTGAATA CGCTGCCAAT CTTAAATCAA GAAAATGCAG  GACACAAAAC GACAATACAA CAATAGTTGA GATGGATCCT GGGAGCCGTA CCACTTTCGA TCTTAGCTAC TACTCGCTAT TGCTAAAGCG TAGGGGATTG TTCGAGTCTG ATTCGGCTCT  TACTAGGGAC TCAAACACGT TGGCATTAAT AAATCAACTC CTTCAAGGAT CACTTCAGAA TTTCTTCAGT GAGTTTGCAA TGTCCATGGA GAAAATGGGT CAGATTGAGG TGAAAACGGG  TACCTCCGGT GAGATCCGAA AGAATTGTGC TGTTGTAAAC AGCTAAGTGT GTAGTCCTTT GATGTTTTAT TTGTTTTGTT TATTTTGTAT TTATGTTTGT TGGGGTGTTT TTATTTTCTA 
TTTATCATTG CAAGTGGGAA AACAACAAAT AAAAAGTTGA TTGTGAGTGA GATTAGAAAT GATGCTTGTG TAATAGAACC AAAATAAGGG AATGAAAATT GCATTGTTTC T 

Retrieve as FASTA