Entry information : HaPrx110 (HanXRQChr16g0513511)
Entry ID 13571
Creation 2016-05-02 (Christophe Dunand)
Last sequence changes 2016-05-02 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2017-11-23 (Catherine Mathe (Scipio))
Peroxidase information: HaPrx110 (HanXRQChr16g0513511)
Name (synonym) HaPrx110 (HanXRQChr16g0513511)
Class Class III peroxidase    [Orthogroup: Prx211]
Taxonomy Eukaryota Viridiplantae Streptophyta Asteraceae Helianthus
Organism Helianthus annuus (Sunflower)    [TaxId: 4232 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HaPrx110
start..stop
S start..stop
HaPrx[P]111 518 0 1..327 1..306
NnPrx44 342 8e-118 1..327 12..339
AcoPrx56 341 2e-117 6..327 4..327
SbPrx81 337 6e-116 29..327 29..334
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 93463110..93463334 225 N° 2 93461927..93462685 759  
complement(join(93461927..93462685,93463110..93463334))


exon

Literature and cross-references HaPrx110 (HanXRQChr16g0513511)
DNA ref. HanXRQ genome:   HanXRQChr16 (93463334..93461927)
Protein sequence: HaPrx110 (HanXRQChr16g0513511)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   327 (301)
PWM (Da):   %s   35630.31 (32675.7)  
PI (pH):   %s   9.41 (9.25) Peptide Signal:   %s   cut: 27 range:27-327
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSRMVIGFLKFTILAIILMAFDRSEAQGPLKMGFYRTTCPAAEQIVRDTVTKVVTANPGMAAGIIRLYFHDCFVRGCDASLLLKPVRGSEGESEQDSFANAGTLRGLEIIDQAKARLEATCPNTVSCADILAFAARDSTNMVGGFSYDIPSGRRDGRVSNLNDVRLPGPDSHLDTLKSSFVEKGLSVRDLVALSGAHSIGRAGCNSIVTRLYSFNGNGTDPSLDPKYATILKRKCPERPLSRKTELDLVTPNRLDNQYYRNIKQQRVPFSSDEALVDSTITARMVTNYAKNPTAWRKDFAAAMVRLGSLDVLTGTRGEIRKKCGVVN*

Retrieve as FASTA  
Remarks
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCTAGGATGGTTATTGGGTTCCTGAAGTTCACTATTTTGGCCATTATTCTAATGGCTTTTGATAGGTCAGAAGCTCAAGGGCCACTAAAAATGGGGTTTTATAGAACTACATGTCCT
GCAGCCGAGCAGATTGTGCGAGATACAGTGACTAAGGTGGTTACGGCTAACCCTGGAATGGCCGCTGGAATCATTCGACTTTACTTCCATGACTGCTTTGTCAGG
GTAATACTGCACCGC
AACAACTAAAAATTGTTACATGTATTTGTAAACATTGTTAAAATGTTAAGCGTTTTTAAGCACGTCTATTCGTGCTAAGAACTTGACAAACATTTACTTATTTCTTTAAGCCGAAAAGAT
AAAATGTGCGCATACTTTGTGCAAGGGCGGAACCAAGGGGGTCAAAGGGGTCTACTGATCCGTCACAAACTTTTATAAAATATGTGTATTATTAGAAAAATATGACTTGAACCATCTAGT
TGCGGTCACGAGAGAAGAGAGCCACCCCCCCCCCCCCCAAAAAAAAAAAAAAAAAAAAACAATTAAGACGTAGACGTTTTTATTTCGACACTGAACTATTGTATTTGTTGTCGCATTTTA
ACAGATTCTAGTCATATACTTGGTTTCACCTTCTGTATCTAAATATTAGGGTTGTGACGCTTCGCTTCTACTTAAGCCGGTACGGGGAAGTGAAGGTGAGTCTGAGCAAGACTCGTTCGC
GAATGCAGGGACCTTGAGAGGCCTGGAGATAATAGATCAAGCTAAAGCCAGACTCGAAGCCACATGTCCAAACACAGTCTCCTGTGCGGACATCTTGGCTTTCGCAGCCCGAGATAGCAC
CAACATGGTTGGTGGGTTCTCTTATGACATACCATCCGGAAGACGGGACGGAAGGGTTTCTAATCTAAACGATGTCCGCCTTCCGGGACCGGACTCTCATCTAGATACCCTGAAAAGTTC
ATTTGTGGAAAAAGGATTGAGCGTTCGTGATCTAGTGGCGCTCTCCGGAGCCCACTCTATAGGTAGAGCTGGGTGCAACTCTATTGTAACCCGTCTCTACTCTTTTAATGGTAATGGTAC
GGATCCCTCGTTGGATCCAAAATATGCAACAATTTTAAAAAGGAAATGCCCGGAGCGTCCACTATCTAGGAAAACCGAACTTGATCTAGTTACTCCGAATCGTCTAGATAATCAGTATTA
CCGTAACATTAAACAACAACGGGTTCCGTTCTCGTCTGATGAAGCTTTGGTTGATAGTACCATAACGGCAAGAATGGTAACTAACTATGCGAAAAACCCCACCGCTTGGAGAAAGGATTT
TGCTGCAGCAATGGTACGTTTAGGTTCTCTTGACGTATTAACAGGGACTAGAGGAGAGATACGTAAGAAGTGTGGGGTTGTAAATTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCTAGGATGGTTATTGGGTTCCTGAAGTTCACTATTTTGGCCATTATTCTAATGGCTTTTGATAGGTCAGAAGCTCAAGGGCCACTAAAAATGGGGTTTTATAGAACTACATGTCCT
GCAGCCGAGCAGATTGTGCGAGATACAGTGACTAAGGTGGTTACGGCTAACCCTGGAATGGCCGCTGGAATCATTCGACTTTACTTCCATGACTGCTTTGTCAGG
GGTTGTGACGCTTCG
CTTCTACTTAAGCCGGTACGGGGAAGTGAAGGTGAGTCTGAGCAAGACTCGTTCGCGAATGCAGGGACCTTGAGAGGCCTGGAGATAATAGATCAAGCTAAAGCCAGACTCGAAGCCACA
TGTCCAAACACAGTCTCCTGTGCGGACATCTTGGCTTTCGCAGCCCGAGATAGCACCAACATGGTTGGTGGGTTCTCTTATGACATACCATCCGGAAGACGGGACGGAAGGGTTTCTAAT
CTAAACGATGTCCGCCTTCCGGGACCGGACTCTCATCTAGATACCCTGAAAAGTTCATTTGTGGAAAAAGGATTGAGCGTTCGTGATCTAGTGGCGCTCTCCGGAGCCCACTCTATAGGT
AGAGCTGGGTGCAACTCTATTGTAACCCGTCTCTACTCTTTTAATGGTAATGGTACGGATCCCTCGTTGGATCCAAAATATGCAACAATTTTAAAAAGGAAATGCCCGGAGCGTCCACTA
TCTAGGAAAACCGAACTTGATCTAGTTACTCCGAATCGTCTAGATAATCAGTATTACCGTAACATTAAACAACAACGGGTTCCGTTCTCGTCTGATGAAGCTTTGGTTGATAGTACCATA
ACGGCAAGAATGGTAACTAACTATGCGAAAAACCCCACCGCTTGGAGAAAGGATTTTGCTGCAGCAATGGTACGTTTAGGTTCTCTTGACGTATTAACAGGGACTAGAGGAGAGATACGT
AAGAAGTGTGGGGTTGTAAATTAA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCTAGGA TGGTTATTGG GTTCCTGAAG TTCACTATTT TGGCCATTAT TCTAATGGCT TTTGATAGGT CAGAAGCTCA AGGGCCACTA AAAATGGGGT TTTATAGAAC TACATGTCCT  GCAGCCGAGC AGATTGTGCG AGATACAGTG ACTAAGGTGG TTACGGCTAA CCCTGGAATG GCCGCTGGAA TCATTCGACT TTACTTCCAT GACTGCTTTG TCAGGGGTTG TGACGCTTCG  CTTCTACTTA AGCCGGTACG GGGAAGTGAA GGTGAGTCTG AGCAAGACTC GTTCGCGAAT GCAGGGACCT TGAGAGGCCT GGAGATAATA GATCAAGCTA AAGCCAGACT CGAAGCCACA  TGTCCAAACA CAGTCTCCTG TGCGGACATC TTGGCTTTCG CAGCCCGAGA TAGCACCAAC ATGGTTGGTG GGTTCTCTTA TGACATACCA TCCGGAAGAC GGGACGGAAG GGTTTCTAAT  CTAAACGATG TCCGCCTTCC GGGACCGGAC TCTCATCTAG ATACCCTGAA AAGTTCATTT GTGGAAAAAG GATTGAGCGT TCGTGATCTA GTGGCGCTCT CCGGAGCCCA CTCTATAGGT  AGAGCTGGGT GCAACTCTAT TGTAACCCGT CTCTACTCTT TTAATGGTAA TGGTACGGAT CCCTCGTTGG ATCCAAAATA TGCAACAATT TTAAAAAGGA AATGCCCGGA GCGTCCACTA  TCTAGGAAAA CCGAACTTGA TCTAGTTACT CCGAATCGTC TAGATAATCA GTATTACCGT AACATTAAAC AACAACGGGT TCCGTTCTCG TCTGATGAAG CTTTGGTTGA TAGTACCATA  ACGGCAAGAA TGGTAACTAA CTATGCGAAA AACCCCACCG CTTGGAGAAA GGATTTTGCT GCAGCAATGG TACGTTTAGG TTCTCTTGAC GTATTAACAG GGACTAGAGG AGAGATACGT 
AAGAAGTGTG GGGTTGTAAA TTAA 

Retrieve as FASTA