Entry information : HaPrx[P]111 ( HanXRQChr16g0513521)
Entry ID 13572
Creation 2016-05-02 (Christophe Dunand)
Last sequence changes 2016-05-02 (Christophe Dunand)
Sequence status theoretical translation / pseudogene
Reviewer Not yet reviewed
Last annotation changes 2017-11-23 (Catherine Mathe (Scipio))
Peroxidase information: HaPrx[P]111 ( HanXRQChr16g0513521)
Name (synonym) HaPrx[P]111 ( HanXRQChr16g0513521)
Class Class III peroxidase    [Orthogroup: N/D] N/D
Taxonomy Eukaryota Viridiplantae Streptophyta Asteraceae Helianthus
Organism Helianthus annuus (Sunflower)    [TaxId: 4232 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HaPrx[P]111
start..stop
S start..stop
HaPrx110 518 0 1..306 1..327
NnPrx44 303 6e-103 13..306 19..339
EguPrx150 300 6e-102 30..306 9..309
EcamPrx122 300 1e-101 1..306 1..337
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 93503532..93503756 225 N° 2 93503063..93503264 202 N° 3 93502517..93503010 494  
complement(join(93502517..93503010,93503063..93503264,93503532..93503756))


exon

Literature and cross-references HaPrx[P]111 ( HanXRQChr16g0513521)
DNA ref. HanXRQ genome:   HanXRQChr16 (93503756..93502517)
Protein sequence: HaPrx[P]111 ( HanXRQChr16g0513521)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   306
PWM (Da):   %s   32997.12  
PI (pH):   %s   8.73
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSRVVIGFLKLTLLAIILVAFDASEAQTPLKMGFYKTTCPTAEQIVRDTVNSAVTANPGMAVGIIRLFFHDCFVRGCDASLLLKPVRGSEGKSEQDAGANAGTLRGMEIIDQAKARLEVVCPNTVSCADILAFAARDSTNIVVNLPSPGSDLDTLKKKFMDKGLSVRELVALSGAHSIGRAECNFVASRLYFFNGNGTDPSLDPEYATTLKKKCPKNQLSRTTELDLVTPNRLDNQYYRNLKKQPVLFSSDEALVDSTITAATVTNYANNPIAWKKDFAAAMVRLGSLDVLTGTRGEIRKKCGVVN

Retrieve as FASTA  
Remarks Pseudogene from genomic. GGFSYDIPDGRVSNVNE is missing due to a frame shift.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCTAGGGTGGTTATTGGTTTCCTGAAGCTCACTCTTTTGGCCATTATTCTAGTGGCTTTTGATGCATCCGAAGCTCAAACACCTTTGAAAATGGGATTTTACAAAACCACATGTCCG
ACTGCCGAGCAGATTGTGCGAGATACGGTGAATAGTGCTGTAACAGCTAACCCGGGAATGGCTGTGGGAATCATTCGACTTTTCTTCCATGATTGTTTTGTCAGG
GTAATACTTCACTAC
AACAATTGAATTTGTTATATGTATATGTGAACATTGTTACAACGTTAAGCGTTTTCAAGTGTGAAGACTTAACAAATATTTACATGCTCTTTAAGCTGCAAACCCAAAATTTGCGCTTAC
TTTGCATAGGAGCGGAACCAAGGGGGTCAAAGAGAACGACCCATTACTAGTTCTTGTTCTGCCACTGACTTTGTGTATATGTACCGTTTATATATATGTTGTAGATGTTTAACTTTTGTA
TCCAAATATTAGGGTTGTGACGCTTCGCTTCTCCTTAAGCCCGTAAGAGGCAGTGAAGGTAAGTCTGAGCAAGACGCAGGTGCAAATGCAGGGACCTTGAGAGGAATGGAGATAATAGAT
CAGGCTAAGGCCAGGCTCGAAGTCGTATGTCCAAACACAGTCTCGTGTGCGGACATCTTGGCTTTTGCGGCCCGAGATAGCACCAACATTGTTG
GTGGTTTCTCTTATGATATACCATGA
CGGAAGGGTTTCCAATGTAAATGAAGTAAACCTTCCATCACCGGGCTCTGATCTAGATACCCTGAAAAAGAAATTCATGGATAAAGGATTAAGTGTTCGTGAACTAGTGGCGCTCTCCGG
AGCCCACTCTATAGGTAGAGCCGAGTGCAACTTTGTTGCATCCCGTCTCTACTTTTTTAATGGTAACGGTACGGATCCCTCGTTGGATCCAGAATATGCAACAACTTTAAAAAAGAAATG
CCCAAAGAATCAGTTGTCTAGGACAACCGAACTTGATCTAGTGACTCCGAATCGTCTAGATAATCAGTATTACCGTAACCTTAAGAAACAACCGGTTTTGTTCTCGTCTGATGAAGCTTT
GGTTGATAGTACCATAACCGCCGCAACGGTGACTAATTATGCGAACAACCCCATCGCTTGGAAAAAGGATTTTGCTGCAGCGATGGTACGTTTAGGTTCTCTTGACGTATTAACAGGGAC
TAGAGGAGAGATACGTAAGAAGTGTGGAGTTGTAAATTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCTAGGGTGGTTATTGGTTTCCTGAAGCTCACTCTTTTGGCCATTATTCTAGTGGCTTTTGATGCATCCGAAGCTCAAACACCTTTGAAAATGGGATTTTACAAAACCACATGTCCG
ACTGCCGAGCAGATTGTGCGAGATACGGTGAATAGTGCTGTAACAGCTAACCCGGGAATGGCTGTGGGAATCATTCGACTTTTCTTCCATGATTGTTTTGTCAGG
GGTTGTGACGCTTCG
CTTCTCCTTAAGCCCGTAAGAGGCAGTGAAGGTAAGTCTGAGCAAGACGCAGGTGCAAATGCAGGGACCTTGAGAGGAATGGAGATAATAGATCAGGCTAAGGCCAGGCTCGAAGTCGTA
TGTCCAAACACAGTCTCGTGTGCGGACATCTTGGCTTTTGCGGCCCGAGATAGCACCAACATTGTTG
TAAACCTTCCATCACCGGGCTCTGATCTAGATACCCTGAAAAAGAAATTCATG
GATAAAGGATTAAGTGTTCGTGAACTAGTGGCGCTCTCCGGAGCCCACTCTATAGGTAGAGCCGAGTGCAACTTTGTTGCATCCCGTCTCTACTTTTTTAATGGTAACGGTACGGATCCC
TCGTTGGATCCAGAATATGCAACAACTTTAAAAAAGAAATGCCCAAAGAATCAGTTGTCTAGGACAACCGAACTTGATCTAGTGACTCCGAATCGTCTAGATAATCAGTATTACCGTAAC
CTTAAGAAACAACCGGTTTTGTTCTCGTCTGATGAAGCTTTGGTTGATAGTACCATAACCGCCGCAACGGTGACTAATTATGCGAACAACCCCATCGCTTGGAAAAAGGATTTTGCTGCA
GCGATGGTACGTTTAGGTTCTCTTGACGTATTAACAGGGACTAGAGGAGAGATACGTAAGAAGTGTGGAGTTGTAAATTAA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCTAGGG TGGTTATTGG TTTCCTGAAG CTCACTCTTT TGGCCATTAT TCTAGTGGCT TTTGATGCAT CCGAAGCTCA AACACCTTTG AAAATGGGAT TTTACAAAAC CACATGTCCG  ACTGCCGAGC AGATTGTGCG AGATACGGTG AATAGTGCTG TAACAGCTAA CCCGGGAATG GCTGTGGGAA TCATTCGACT TTTCTTCCAT GATTGTTTTG TCAGGGGTTG TGACGCTTCG  CTTCTCCTTA AGCCCGTAAG AGGCAGTGAA GGTAAGTCTG AGCAAGACGC AGGTGCAAAT GCAGGGACCT TGAGAGGAAT GGAGATAATA GATCAGGCTA AGGCCAGGCT CGAAGTCGTA  TGTCCAAACA CAGTCTCGTG TGCGGACATC TTGGCTTTTG CGGCCCGAGA TAGCACCAAC ATTGTTGTAA ACCTTCCATC ACCGGGCTCT GATCTAGATA CCCTGAAAAA GAAATTCATG  GATAAAGGAT TAAGTGTTCG TGAACTAGTG GCGCTCTCCG GAGCCCACTC TATAGGTAGA GCCGAGTGCA ACTTTGTTGC ATCCCGTCTC TACTTTTTTA ATGGTAACGG TACGGATCCC  TCGTTGGATC CAGAATATGC AACAACTTTA AAAAAGAAAT GCCCAAAGAA TCAGTTGTCT AGGACAACCG AACTTGATCT AGTGACTCCG AATCGTCTAG ATAATCAGTA TTACCGTAAC  CTTAAGAAAC AACCGGTTTT GTTCTCGTCT GATGAAGCTT TGGTTGATAG TACCATAACC GCCGCAACGG TGACTAATTA TGCGAACAAC CCCATCGCTT GGAAAAAGGA TTTTGCTGCA 
GCGATGGTAC GTTTAGGTTC TCTTGACGTA TTAACAGGGA CTAGAGGAGA GATACGTAAG AAGTGTGGAG TTGTAAATTA A 

Retrieve as FASTA