Entry information : HaPrx112 (HanXRQChr16g0526541)
Entry ID 13573
Creation 2016-05-02 (Christophe Dunand)
Last sequence changes 2016-05-02 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2017-11-23 (Catherine Mathe (Scipio))
Peroxidase information: HaPrx112 (HanXRQChr16g0526541)
Name (synonym) HaPrx112 (HanXRQChr16g0526541)
Class Class III peroxidase     [Orthogroup: Prx094]*
Taxonomy Eukaryota Viridiplantae Streptophyta Asteraceae Helianthus
Organism Helianthus annuus (Sunflower)    [TaxId: 4232 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HaPrx112
start..stop
S start..stop
HargPrx20 475 1e-170 1..320 1..320
HaPrx01_QIR8 474 3e-170 1..320 1..320
HaPrx01 468 6e-168 1..320 1..320
HaPrx127 452 2e-161 1..319 1..319
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 161347043..161347267 225 N° 2 161347363..161347536 174 N° 3 161347841..161348009 169 N° 4 161348104..161348498 395
join(161347043..161347267,161347363..161347536,161347841..161348009,161348104..1 61348498)


exon

Literature and cross-references HaPrx112 (HanXRQChr16g0526541)
DNA ref. HanXRQ genome:   HanXRQChr16 (161347043..161348498)
Protein sequence: HaPrx112 (HanXRQChr16g0526541)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   320 (292)
PWM (Da):   %s   34242.9 (31156.2)  
PI (pH):   %s   4.96 (4.63) Peptide Signal:   %s   cut: 29 range:29-320
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MGYHKSMGTILVPILVLLLSLNYMPCKAQLSTTFYDNTCPNALSTIQTSVSAAVSRNRRNAALLIRLHFHDCFVQGCDASLLLEGSEKSAPANNGVLGYDIIDDVKAAVEGVCPGVVSCADILAVAARDASVEVGGPSWSVRLGRRDSPSSATADEAANNLPRGNMDLTQLLDNFRRKNLSPRDMVALSGSHTIGQARCVTFRARIYNNASDIDATFANNLRSNCPANAPDGNGNLEPLDLVTPNTFDNNYYRNLRDRRGLLASDQVLFSGDSTDSIVTEYIDNPSTFDSDFAAAMVRMSEIEPLTGSSGLIRTLCSASS

Retrieve as FASTA  
Remarks
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGTTATCATAAGTCTATGGGAACTATATTGGTTCCTATACTAGTTTTACTTTTATCATTGAACTACATGCCATGCAAAGCTCAGTTGTCTACCACCTTTTATGATAACACATGCCCT
AATGCCCTTTCAACTATTCAAACTTCTGTTAGTGCTGCCGTGTCGAGGAATCGTCGCAATGCAGCCTTACTCATTCGCCTTCATTTTCACGACTGTTTCGTTCAG
GTTATGATCATTATA
CCATGGTGTTTATTTAAAAAAAAAATAGAAATAAAAACATGCATATGTAATTAATTAAAGTAATCTGTTTGATTCTGCAGGGTTGTGATGCATCCCTTTTGCTAGAAGGGAGTGAGAAGT
CAGCACCTGCTAATAATGGTGTGTTGGGCTATGATATTATCGATGATGTTAAAGCTGCTGTCGAGGGCGTATGCCCTGGAGTTGTTTCGTGTGCAGATATATTGGCTGTTGCAGCACGCG
ATGCTTCCGTGGAG
GTAATAACAAAACTACAGCACTATACCGGTTAGATATAAAATATAGGTTCATAAAATTATTTCACTGGTAAATTAAGGTTGTGTACCTAAAGAATCCTCATGTATC
AGTATTAATCAACCATGATCCGCCTCTTTAATATAGAAGTGTAACATAATTAGAACATAATGAGAAAAATAATAAAACGTGAATAACAATCCTATTACTCTAGAATAATAACTAATAAAC
CAACTTAAAGATACATGATAGTTTATGTAACAATACCTATAATAGATAATAAACTCAGCTAACAATTACAATATGTAGGTGGGGGGTCCGTCATGGTCGGTAAGACTTGGAAGAAGAGAT
TCTCCATCTTCGGCAACTGCCGATGAGGCGGCTAATAATCTCCCAAGAGGAAATATGGATCTAACTCAACTCCTTGATAACTTTCGTCGAAAGAATCTCAGCCCAAGAGACATGGTTGCT
TTATCAG
GTTAGATCAGTAAATTTTTCTTACTTGTCCTTAGCCACCATATAATCTATATTTTCACATTGATGAAACATGAACAATAATTGTTGTCCTTCAGGGTCTCACACAATTGGGCA
GGCACGATGTGTTACGTTTAGAGCACGGATATACAACAATGCCTCAGACATAGATGCTACTTTCGCTAACAACCTTAGGAGCAACTGCCCAGCGAATGCACCTGATGGCAATGGTAACTT
GGAGCCACTTGATTTAGTGACACCAAATACATTTGACAACAACTACTACAGGAACCTAAGAGATAGAAGAGGTCTTCTTGCGTCGGACCAGGTACTCTTCAGTGGAGACTCAACTGATAG
CATTGTGACTGAGTACATCGACAATCCTTCGACATTTGATTCTGATTTCGCGGCTGCCATGGTTAGGATGAGTGAAATTGAACCCCTTACTGGTTCTAGTGGCCTGATAAGGACTCTTTG
CTCCGCTTCTAGTTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGTTATCATAAGTCTATGGGAACTATATTGGTTCCTATACTAGTTTTACTTTTATCATTGAACTACATGCCATGCAAAGCTCAGTTGTCTACCACCTTTTATGATAACACATGCCCT
AATGCCCTTTCAACTATTCAAACTTCTGTTAGTGCTGCCGTGTCGAGGAATCGTCGCAATGCAGCCTTACTCATTCGCCTTCATTTTCACGACTGTTTCGTTCAG
GGTTGTGATGCATCC
CTTTTGCTAGAAGGGAGTGAGAAGTCAGCACCTGCTAATAATGGTGTGTTGGGCTATGATATTATCGATGATGTTAAAGCTGCTGTCGAGGGCGTATGCCCTGGAGTTGTTTCGTGTGCA
GATATATTGGCTGTTGCAGCACGCGATGCTTCCGTGGAG
GTGGGGGGTCCGTCATGGTCGGTAAGACTTGGAAGAAGAGATTCTCCATCTTCGGCAACTGCCGATGAGGCGGCTAATAAT
CTCCCAAGAGGAAATATGGATCTAACTCAACTCCTTGATAACTTTCGTCGAAAGAATCTCAGCCCAAGAGACATGGTTGCTTTATCAG
GGTCTCACACAATTGGGCAGGCACGATGTGTT
ACGTTTAGAGCACGGATATACAACAATGCCTCAGACATAGATGCTACTTTCGCTAACAACCTTAGGAGCAACTGCCCAGCGAATGCACCTGATGGCAATGGTAACTTGGAGCCACTTGAT
TTAGTGACACCAAATACATTTGACAACAACTACTACAGGAACCTAAGAGATAGAAGAGGTCTTCTTGCGTCGGACCAGGTACTCTTCAGTGGAGACTCAACTGATAGCATTGTGACTGAG
TACATCGACAATCCTTCGACATTTGATTCTGATTTCGCGGCTGCCATGGTTAGGATGAGTGAAATTGAACCCCTTACTGGTTCTAGTGGCCTGATAAGGACTCTTTGCTCCGCTTCTAGT
TAA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
CTCATTCAAC AATTAACACA CAGTATGTGT ATATATAGCA ATCAGTAGGT GACTGTTCTT ACATCAAATC TAGCTAGCTT CCTATTGTCA AAAGCAAGAG GCTAAAGCTT TACTTTTCTC  TTCAATCATA TGGGTTATCA TAAGTCTATG GGAACTATAT TGGTTCCTAT ACTAGTTTTA CTTTTATCAT TGAACTACAT GCCATGCAAA GCTCAGTTGT CTACCACCTT TTATGATAAC  ACATGCCCTA ATGCCCTTTC AACTATTCAA ACTTCTGTTA GTGCTGCCGT GTCGAGGAAT CGTCGCAATG CAGCCTTACT CATTCGCCTT CATTTTCACG ACTGTTTCGT TCAGGGTTGT  GATGCATCCC TTTTGCTAGA AGGGAGTGAG AAGTCAGCAC CTGCTAATAA TGGTGTGTTG GGCTATGATA TTATCGATGA TGTTAAAGCT GCTGTCGAGG GCGTATGCCC TGGAGTTGTT  TCGTGTGCAG ATATATTGGC TGTTGCAGCA CGCGATGCTT CCGTGGAGGT GGGGGGTCCG TCATGGTCGG TAAGACTTGG AAGAAGAGAT TCTCCATCTT CGGCAACTGC CGATGAGGCG  GCTAATAATC TCCCAAGAGG AAATATGGAT CTAACTCAAC TCCTTGATAA CTTTCGTCGA AAGAATCTCA GCCCAAGAGA CATGGTTGCT TTATCAGGGT CTCACACAAT TGGGCAGGCA  CGATGTGTTA CGTTTAGAGC ACGGATATAC AACAATGCCT CAGACATAGA TGCTACTTTC GCTAACAACC TTAGGAGCAA CTGCCCAGCG AATGCACCTG ATGGCAATGG TAACTTGGAG  CCACTTGATT TAGTGACACC AAATACATTT GACAACAACT ACTACAGGAA CCTAAGAGAT AGAAGAGGTC TTCTTGCGTC GGACCAGGTA CTCTTCAGTG GAGACTCAAC TGATAGCATT  GTGACTGAGT ACATCGACAA TCCTTCGACA TTTGATTCTG ATTTCGCGGC TGCCATGGTT AGGATGAGTG AAATTGAACC CCTTACTGGT TCTAGTGGCC TGATAAGGAC TCTTTGCTCC  GCTTCTAGTT AATAAAGAAC ATATATGATA TGTAATGATA CTAATATATT GATATCGATC CGCATGAAGT AGCAAGTAGC ACATAGTGCA GTCACATGTA TTATGGAAGC TTTACGTTGT  TTTGTTCACA AGCAATAAAA TTATTCTTCT ACTAGGAAAC TTATTTACTA ATAGATATGT ATTACAAATG AAATAAACAA ATAAAGAATA GCAGAAGTAT GGTTGAGCAT TTGTGCTTAA 
CAAAAATAGA TTCAACGTGT 

Retrieve as FASTA