Entry information : PtroGPx01-A (GPX1 / GSHPx-1 / PtroGPx01-A)
Entry ID 1358
Creation 2009-02-02 (Christophe Dunand)
Last sequence changes 2010-10-21 (Christophe Dunand)
Sequence status complete
Reviewer Catherine Mathe
Last annotation changes 2012-05-11 (Christophe Dunand)
Peroxidase information: PtroGPx01-A (GPX1 / GSHPx-1 / PtroGPx01-A)
Name (synonym) PtroGPx01-A (GPX1 / GSHPx-1 / PtroGPx01-A)
Class Animal glutathione peroxidase    [Orthogroup: Gpx1003]
Taxonomy Eukaryota Metazoa Chordata Mammalia Hominidae Pan
Organism Pan troglodytes (chimpanzee)    [TaxId: 9598 ]
Cellular localisation N/D
Tissue type Roots
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PtroGPx01-A
start..stop
S start..stop
HlGPx01 412 1.55e-149 1..201 1..201
PpyGPx01 411 2.35e-149 1..201 1..201
HsGPx01-A 409 2.32e-148 1..201 1..203
MfGPx01 408 5.66e-148 1..201 1..201
Gene structure Fichier Exons


exon

Literature and cross-references PtroGPx01-A (GPX1 / GSHPx-1 / PtroGPx01-A)
Literature Chimpanzee Sequencing and Analysis Consortium. Initial sequence of the chimpanzee genome and comparison with the human genome. Nature 437 (7055), 69-87 (2005).
Protein ref. UniProtKB:   Q0EFA0
DNA ref. GenBank:   NC_006490.2 (50523230..50522354)
mRNA ref. GenBank:   AB120996
Protein sequence: PtroGPx01-A (GPX1 / GSHPx-1 / PtroGPx01-A)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   201
PWM (Da):   %s   21711.05  
PI (pH):   %s   6.52
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MCAARLAAAAAQSVYAFSARPLAGGEPVSLGSLRGKVLLIENVASLUGTTVRDYTQMNELQRRLGPRGLVVLGFPCNQFGHQENAKNEEILNSLKYVRPGGGFEPNFMLFEKCEVNGAGA
HPLFAFLREALPAPSDDATALMTDPKLITWSPVCRNDVAWNFEKFLVGPDGVPLRRYSRRFQTIDIEPDIEALLSQGPSCA

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 3, 1 intron) and 7 ESTs.
DNA
Send to BLAST
CDS
Send to BLAST