Entry information : HaPrx123 (HanXRQChr17g0543601)
Entry ID 13584
Creation 2016-05-02 (Christophe Dunand)
Last sequence changes 2016-05-02 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2017-11-23 (Catherine Mathe (Scipio))
Peroxidase information: HaPrx123 (HanXRQChr17g0543601)
Name (synonym) HaPrx123 (HanXRQChr17g0543601)
Class Class III peroxidase    [Orthogroup: Prx010]
Taxonomy Eukaryota Viridiplantae Streptophyta Asteraceae Helianthus
Organism Helianthus annuus (Sunflower)    [TaxId: 4232 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HaPrx123
start..stop
S start..stop
HaPrx05 651 0 1..324 1..324
LsaPrx31 592 0 1..324 1..325
LvPrx31 590 0 1..322 1..323
HaPrx108 577 0 1..324 1..324
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 34871244..34871441 198 N° 2 34870583..34870780 198 N° 3 34870308..34870470 163 N° 4 34869608..34870023 416
complement(join(34869608..34870023,34870308..34870470,34870583..34870780,3487124 4..34871441))


exon

Literature and cross-references HaPrx123 (HanXRQChr17g0543601)
DNA ref. HanXRQ genome:   HanXRQChr17 (34871441..34869608)
Protein sequence: HaPrx123 (HanXRQChr17g0543601)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   324 (305)
PWM (Da):   %s   35452.89 (33242.7)  
PI (pH):   %s   6.35 (6.03) Peptide Signal:   %s   cut: 20 range:20-324
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MKGFCWILVFVVIFGWVQGDLQMGFYGTSCPKAEKIVQDYVNEHIPNAPSLAATLIRMHFHDCFVRGCDASILLNVTSSSGNQTEKVATPNQTVRGFDFIDRLKSLVEAECPGIVSCADIIALAARDSIAITGGPSWKVPTGRRDGLLSNASEALNQIPAPFDNITILIQKFANKSLDLKDLVLLSGAHTIGIAHCPSVSNRLYNFTGVGDRDPSLDSEYADNLRATKCRTQNDNTTILEMDPGSRKTFDLSYYTLLLKRRGLFESDSALTTNSNTLAYINQLLQGSLQNFFNEFALSMEKMGQIEVKTGTTGEIRRNCAVVNS

Retrieve as FASTA  
Remarks
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAAGGCTTTTGCTGGATTTTGGTTTTTGTAGTGATTTTTGGATGGGTGCAAGGTGATTTACAGATGGGGTTTTATGGGACTTCATGCCCCAAAGCTGAAAAGATTGTGCAAGATTAT
GTGAATGAGCATATCCCGAATGCTCCATCGCTTGCCGCTACTCTTATCAGAATGCATTTCCATGATTGTTTCGTCAGG
GTTCGTTTCATCTTTTACCTTTTTTCCTCGTGTCATTTCTCA
CGCGAGTTTTTAAATATCGCTGCTTTTCTACTCTCTACCGTAGATTTGTCTGTTTATTTAGTTGGGTATCACTTTTTACATTTTATGTTCCCAAACATTTTTTAGTTAAATGATGCCTAA
CAAATATTTGATCATAAACACCCGGAAGTACCCTAAAAAAGGAACCTTTGCTCTCCCCAGCCATTTCGGATTAAGAAGAACTCGAACATTTACCCAAATAGTGTGGTCACAATGAAAACA
AGCACAACTTTAAAAAATGACTTTTCAACTACATTTGAGTTTAGATACTCGAATTTCGGCTAGAAACAAATATGCGCCTACTTTACGCGTCCAAATTGTTACCGGGTCAACACGTATGAT
CATTTAACCGTTAAAAAAATGACGATTTTATTTCTTAACGAAACATTGGTGTTGTGAATAGGGTTGTGATGCATCAATCCTCTTGAATGTTACTTCAAGCTCAGGGAATCAGACAGAGAA
AGTGGCAACACCAAACCAGACAGTAAGAGGGTTTGATTTCATTGATAGATTGAAGAGCTTAGTTGAAGCAGAATGCCCTGGCATTGTTTCATGTGCTGATATTATCGCTCTTGCTGCTAG
AGACTCCATTGCTATCACT
GTAAGAGTTCAAATATTATTACAAGTGAAATAAAACCGGAAGGTAATATATAAATACCAACTATTAATGTTTTTGTTTCTGATTCCTTTTCTTGTTTTCGG
TTTTGTTAAAGGGAGGCCCTTCTTGGAAAGTCCCCACGGGGCGAAGAGATGGGTTGTTATCCAATGCATCCGAGGCGTTGAACCAAATCCCGGCTCCATTCGACAATATCACTATCCTCA
TACAAAAGTTTGCCAATAAAAGTCTTGATTTGAAGGATCTTGTTTTGCTTTCGG
GTATGTTATTCATTGCTTAAGTCACTATTAAATTGGATGCGTTTTGTTTTAGTATCTTGTAATTTA
TACAATTAGATTATTTGATCAAATAGTATAGCGGTATGCTTTTAAAACATCTATAATAAATAGTTTGTGTGTTAAAAATATATTGTTATAATAATAATAATATATTTTTAAAATTATGCA
ATTTAGTTTTGTATGCTACAGAATGCATATTTCAGACTTTCAAACTCCTTTAAGATGTTACCCGTTCAAATTTTCACATATTTGTGACGTTATATTAGGTGCTCATACTATTGGGATCGC
ACATTGTCCATCGGTATCAAACCGTCTATACAATTTCACGGGTGTGGGAGATCGAGACCCCTCGCTTGATAGTGAATATGCAGACAATCTCAGAGCAACAAAATGCAGGACACAAAACGA
CAATACAACAATACTTGAGATGGATCCTGGGAGCCGTAAGACTTTTGATCTTAGCTACTACACGTTATTGCTAAAACGTAGGGGCTTGTTCGAGTCTGATTCGGCTTTGACTACAAACTC
CAACACGTTGGCATACATAAACCAACTTCTTCAAGGATCGCTCCAGAATTTCTTCAATGAGTTTGCATTGTCGATGGAGAAAATGGGTCAAATTGAGGTAAAAACCGGAACCACTGGTGA
AATTCGAAGGAATTGTGCTGTCGTAAATAGTTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAAGGCTTTTGCTGGATTTTGGTTTTTGTAGTGATTTTTGGATGGGTGCAAGGTGATTTACAGATGGGGTTTTATGGGACTTCATGCCCCAAAGCTGAAAAGATTGTGCAAGATTAT
GTGAATGAGCATATCCCGAATGCTCCATCGCTTGCCGCTACTCTTATCAGAATGCATTTCCATGATTGTTTCGTCAGG
GGTTGTGATGCATCAATCCTCTTGAATGTTACTTCAAGCTCA
GGGAATCAGACAGAGAAAGTGGCAACACCAAACCAGACAGTAAGAGGGTTTGATTTCATTGATAGATTGAAGAGCTTAGTTGAAGCAGAATGCCCTGGCATTGTTTCATGTGCTGATATT
ATCGCTCTTGCTGCTAGAGACTCCATTGCTATCACT
GGAGGCCCTTCTTGGAAAGTCCCCACGGGGCGAAGAGATGGGTTGTTATCCAATGCATCCGAGGCGTTGAACCAAATCCCGGCT
CCATTCGACAATATCACTATCCTCATACAAAAGTTTGCCAATAAAAGTCTTGATTTGAAGGATCTTGTTTTGCTTTCGG
GTGCTCATACTATTGGGATCGCACATTGTCCATCGGTATCA
AACCGTCTATACAATTTCACGGGTGTGGGAGATCGAGACCCCTCGCTTGATAGTGAATATGCAGACAATCTCAGAGCAACAAAATGCAGGACACAAAACGACAATACAACAATACTTGAG
ATGGATCCTGGGAGCCGTAAGACTTTTGATCTTAGCTACTACACGTTATTGCTAAAACGTAGGGGCTTGTTCGAGTCTGATTCGGCTTTGACTACAAACTCCAACACGTTGGCATACATA
AACCAACTTCTTCAAGGATCGCTCCAGAATTTCTTCAATGAGTTTGCATTGTCGATGGAGAAAATGGGTCAAATTGAGGTAAAAACCGGAACCACTGGTGAAATTCGAAGGAATTGTGCT
GTCGTAAATAGTTAA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TATTTTTTAA CAAAATATAA TGTTATAAAT AAAAGCTCAA CCTTTCATAC ATCTTCCACA TATCCATGAA TCTGATGTCA CTTAAGCAAG AGGATTAGTT GAGGTGATAC TGCCTATATA  ATAGATCGAA GTTTCTAAAG AAGAAATAGG TGAAAGAAGG CAACAAAGAG AAGACATGAA AGGCTTTTGC TGGATTTTGG TTTTTGTAGT GATTTTTGGA TGGGTGCAAG GTGATTTACA  GATGGGGTTT TATGGGACTT CATGCCCCAA AGCTGAAAAG ATTGTGCAAG ATTATGTGAA TGAGCATATC CCGAATGCTC CATCGCTTGC CGCTACTCTT ATCAGAATGC ATTTCCATGA  TTGTTTCGTC AGGGGTTGTG ATGCATCAAT CCTCTTGAAT GTTACTTCAA GCTCAGGGAA TCAGACAGAG AAAGTGGCAA CACCAAACCA GACAGTAAGA GGGTTTGATT TCATTGATAG  ATTGAAGAGC TTAGTTGAAG CAGAATGCCC TGGCATTGTT TCATGTGCTG ATATTATCGC TCTTGCTGCT AGAGACTCCA TTGCTATCAC TGGAGGCCCT TCTTGGAAAG TCCCCACGGG  GCGAAGAGAT GGGTTGTTAT CCAATGCATC CGAGGCGTTG AACCAAATCC CGGCTCCATT CGACAATATC ACTATCCTCA TACAAAAGTT TGCCAATAAA AGTCTTGATT TGAAGGATCT  TGTTTTGCTT TCGGGTGCTC ATACTATTGG GATCGCACAT TGTCCATCGG TATCAAACCG TCTATACAAT TTCACGGGTG TGGGAGATCG AGACCCCTCG CTTGATAGTG AATATGCAGA  CAATCTCAGA GCAACAAAAT GCAGGACACA AAACGACAAT ACAACAATAC TTGAGATGGA TCCTGGGAGC CGTAAGACTT TTGATCTTAG CTACTACACG TTATTGCTAA AACGTAGGGG  CTTGTTCGAG TCTGATTCGG CTTTGACTAC AAACTCCAAC ACGTTGGCAT ACATAAACCA ACTTCTTCAA GGATCGCTCC AGAATTTCTT CAATGAGTTT GCATTGTCGA TGGAGAAAAT  GGGTCAAATT GAGGTAAAAA CCGGAACCAC TGGTGAAATT CGAAGGAATT GTGCTGTCGT AAATAGTTAA GATTGTGTGA TCCTAAAATG CTTGTTTTAT TTGTTTTCGT CATTTTATTT  TCAAATTTTG CGTGGTAAGT TTTATGTGGT AAGAAAATAA AGACGTGACT ATGAGAGTTT ATTTACACTG TATGTAAATT GAAATGATGC TTGTATAATT AAGATATAGA ATCGAACAAA 
AAGATATGAA TATATATGAC ATTGTTTCTA TTTTCTGTTT TATTAGTTAC TATACTCTTA TCACAAGCAT AACTTAA 

Retrieve as FASTA