Entry information : HaPrx[P]124 (HanXRQChr17g0551271)
Entry ID 13585
Creation 2016-05-02 (Christophe Dunand)
Last sequence changes 2016-05-02 (Christophe Dunand)
Sequence status theoretical translation / pseudogene
Reviewer Not yet reviewed
Last annotation changes 2017-11-23 (Catherine Mathe (Scipio))
Peroxidase information: HaPrx[P]124 (HanXRQChr17g0551271)
Name (synonym) HaPrx[P]124 (HanXRQChr17g0551271)
Class Class III peroxidase     [Orthogroup: Prx040]*
Taxonomy Eukaryota Viridiplantae Streptophyta Asteraceae Helianthus
Organism Helianthus annuus (Sunflower)    [TaxId: 4232 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HaPrx[P]124
start..stop
S start..stop
HaPrx[P]135 382 6e-138 11..203 1..193
HaPrx133 392 7e-138 1..203 260..464
HaPrx54 378 3e-134 1..203 118..322
HaPrx[P]125 366 8e-132 1..187 1..187
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 71293550..71293579 30 N° 2 71293658..71293820 163 N° 3 71293936..71294354 419  
join(71293550..71293579,71293658..71293820,71293936..71294354)


exon

Literature and cross-references HaPrx[P]124 (HanXRQChr17g0551271)
DNA ref. HanXRQ genome:   HanXRQChr17 (71293550..71294354)
Protein sequence: HaPrx[P]124 (HanXRQChr17g0551271)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   203
PWM (Da):   %s   22224.25  
PI (pH):   %s   9.53
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MLGVASRYHGTGGSGWAVPTRRRDRLVSLASDAESIPGPKDSIDDQIKKFANKGLSIEDLVTLVGGHTIGTAGCVTFSDRLYNYNNTNAPDPAIDQGFLLHLQTLCPLSGDLTRRVALDTNSENNFDNSFYENIRRGRGVLESDSKLWSDPRTQKFAQPFIGASRSHGSTFNKMFAIAMVKMSKIELKTGNQGEIRRVCNRIN

Retrieve as FASTA  
Remarks Pseudogene from genomic (only exons 3 and 4 are detected).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTTGGGTGTTGCATCTCGGTATCATGGTGTACATGAAAGTTTTGCCCTCATTAATTCCTTGCTATGAGTAGAATCTTACTGAGTACGTTTATTTGTATTGTTTTAGACTGGGGGAAGT
GGTTGGGCAGTGCCAACACGTCGTCGAGACAGATTAGTTTCACTGGCATCTGATGCAGAAAGCATACCTGGTCCTAAAGACTCCATTGATGACCAAATCAAGAAGTTTGCTAACAAAGGT
CTTAGCATTGAAGATCTTGTTACCCTTGTAG
GTAAGTTAAGACTAAAAGCTAGAACAGTAGCCATAACGACAAATTAACATTGGAATGGATTTAGTTTCAAATGAACTAACTTGCATATT
TTGCGGTTTAATTCAATGATTATCAGGAGGACATACGATTGGGACAGCTGGCTGTGTCACATTCAGTGACAGGCTATATAACTACAACAATACTAATGCACCCGACCCTGCTATTGACCA
AGGATTCCTTCTCCATCTTCAAACCCTATGTCCTCTTAGCGGTGATCTTACAAGGCGAGTGGCCTTGGATACAAACAGCGAAAACAATTTCGACAACTCATTCTATGAAAACATAAGGCG
TGGACGAGGAGTACTTGAATCTGATTCAAAGCTGTGGAGTGACCCACGAACACAAAAGTTTGCGCAACCGTTTATTGGAGCTAGCAGATCGCATGGATCGACATTCAACAAGATGTTCGC
GATAGCAATGGTGAAGATGAGTAAAATTGAGTTAAAGACAGGTAATCAAGGAGAAATTCGTAGGGTTTGTAATAGAATTAATTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTTGGGTGTTGCATCTCGGTATCATGGTACTGGGGGAAGTGGTTGGGCAGTGCCAACACGTCGTCGAGACAGATTAGTTTCACTGGCATCTGATGCAGAAAGCATACCTGGTCCTAAA
GACTCCATTGATGACCAAATCAAGAAGTTTGCTAACAAAGGTCTTAGCATTGAAGATCTTGTTACCCTTGTAG
GAGGACATACGATTGGGACAGCTGGCTGTGTCACATTCAGTGACAGG
CTATATAACTACAACAATACTAATGCACCCGACCCTGCTATTGACCAAGGATTCCTTCTCCATCTTCAAACCCTATGTCCTCTTAGCGGTGATCTTACAAGGCGAGTGGCCTTGGATACA
AACAGCGAAAACAATTTCGACAACTCATTCTATGAAAACATAAGGCGTGGACGAGGAGTACTTGAATCTGATTCAAAGCTGTGGAGTGACCCACGAACACAAAAGTTTGCGCAACCGTTT
ATTGGAGCTAGCAGATCGCATGGATCGACATTCAACAAGATGTTCGCGATAGCAATGGTGAAGATGAGTAAAATTGAGTTAAAGACAGGTAATCAAGGAGAAATTCGTAGGGTTTGTAAT
AGAATTAATTAA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTTGGGTG TTGCATCTCG GTATCATGGT ACTGGGGGAA GTGGTTGGGC AGTGCCAACA CGTCGTCGAG ACAGATTAGT TTCACTGGCA TCTGATGCAG AAAGCATACC TGGTCCTAAA  GACTCCATTG ATGACCAAAT CAAGAAGTTT GCTAACAAAG GTCTTAGCAT TGAAGATCTT GTTACCCTTG TAGGAGGACA TACGATTGGG ACAGCTGGCT GTGTCACATT CAGTGACAGG  CTATATAACT ACAACAATAC TAATGCACCC GACCCTGCTA TTGACCAAGG ATTCCTTCTC CATCTTCAAA CCCTATGTCC TCTTAGCGGT GATCTTACAA GGCGAGTGGC CTTGGATACA  AACAGCGAAA ACAATTTCGA CAACTCATTC TATGAAAACA TAAGGCGTGG ACGAGGAGTA CTTGAATCTG ATTCAAAGCT GTGGAGTGAC CCACGAACAC AAAAGTTTGC GCAACCGTTT  ATTGGAGCTA GCAGATCGCA TGGATCGACA TTCAACAAGA TGTTCGCGAT AGCAATGGTG AAGATGAGTA AAATTGAGTT AAAGACAGGT AATCAAGGAG AAATTCGTAG GGTTTGTAAT 
AGAATTAATT AA 

Retrieve as FASTA