Entry information : HaPrx39 (HanXRQChr01g0003431/HanXRQChr01g0003451)
Entry ID 13593
Creation 2016-05-02 (Christophe Dunand)
Last sequence changes 2016-05-02 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2017-11-23 (Catherine Mathe (Scipio))
Peroxidase information: HaPrx39 (HanXRQChr01g0003431/HanXRQChr01g0003451)
Name (synonym) HaPrx39 (HanXRQChr01g0003431/HanXRQChr01g0003451)
Class Class III peroxidase    [Orthogroup: Prx005]
Taxonomy Eukaryota Viridiplantae Streptophyta Asteraceae Helianthus
Organism Helianthus annuus (Sunflower)    [TaxId: 4232 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HaPrx39
start..stop
S start..stop
HaPrx[P]64 622 0 1..325 1..327
HaPrx65 580 0 1..325 1..329
HaPrx44 580 0 1..325 1..329
HaPrx33 576 0 1..325 21..349
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 15746257..15746481 225 N° 2 15745968..15746153 186 N° 3 15745645..15745819 175 N° 4 15745362..15745515 154
N° 5 15741703..15741940 238  
complement(join(15741703..15741940,15745362..15745515,15745645..15745819,1574596 8..15746153,15746257..15746481))


exon

Literature and cross-references HaPrx39 (HanXRQChr01g0003431/HanXRQChr01g0003451)
DNA ref. HanXRQ genome:   HanXRQChr01 (15746481..15741703)
Protein sequence: HaPrx39 (HanXRQChr01g0003431/HanXRQChr01g0003451)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   325 (298)
PWM (Da):   %s   35260.95 (32269.4) Transmb domain:   %s   i7-25o
PI (pH):   %s   8.2 (8.21) Peptide Signal:   %s   cut: 28 range:28-325
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MATYKNSFGYFVLPVMVLAFLTLQAEGQGLKVGFYEKSCPHAEKIVTTVINEVMAVAPSLSGPLLRMHFHDCYIRGCDGSVLLDSPTNQSEKFAPPNLSLRGFNIVDRVKLALENACPGVVSCADIVALVARDVTVATKGPFWEVETGRRDGNVSLISDPINPATGLPPFFASINLLKQSFALRGLNTKDLVVLSGGHTIGMSHCSSFDSRLYNFTGIGDTDPSMDPNYIARLKLKCKQGDQTTLADGFKTFDDSYYRLVTKRRGLLQSDAALLNDPETRAYLVQSTSHGSTFFTDFGVSMVKMGRIGVLTGSQGEVRKVCSKRN

Retrieve as FASTA  
Remarks Complete sequence from genomic. No EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCACTTACAAAAACTCATTTGGATATTTTGTGCTTCCAGTTATGGTTCTAGCATTCTTAACTCTCCAAGCAGAAGGCCAAGGCTTAAAAGTTGGGTTCTATGAGAAATCATGCCCA
CATGCTGAAAAGATCGTAACTACGGTCATCAATGAAGTTATGGCAGTCGCCCCGTCACTTTCTGGCCCATTGTTGAGAATGCATTTCCACGACTGCTACATTCGG
GTTTGTAACATGTTA
TATTATCATATAATTCAAGTTCACTTCTTAGATTATTTCATCATCTAACGTGAATGTGTTTTATGATTTATGAACGTTTCATTTGTAGGGTTGTGATGGTTCAGTTTTATTGGACTCTCC
AACAAATCAATCCGAGAAATTTGCACCCCCGAATCTCAGCCTGAGAGGGTTTAATATCGTTGATAGAGTGAAGTTGGCGTTAGAAAATGCCTGTCCAGGTGTAGTTTCTTGTGCTGACAT
CGTAGCCCTTGTTGCCAGAGACGTTACTGTGGCG
GTAGATTTATCCCCCATTCAAATCTAATGCTAAAATTAGCTTCATGTGTATAGCATGATAATGCCGACATTTTGGATACAATGTTC
ATTTTTCTTGTGATAATAATGATTCATCATCTTCTTATACGACGAACCTCTTTTGTTAACAGACCAAGGGACCATTTTGGGAGGTCGAAACTGGCCGAAGAGACGGAAATGTGTCTTTAA
TCAGTGATCCCATAAATCCAGCAACAGGATTACCGCCATTTTTTGCAAGTATTAATCTTTTGAAACAATCATTTGCACTGAGGGGACTAAACACAAAAGATCTTGTGGTTCTCTCTG
GTA
CGTTAATGAGTGTTTTTATTTTCCAGGAACCTTTCTTACAAATTCATATCTTCAGCAAAGTTAGTATCAAAGTGATTAGTTTCCAGATTGTTCGTAACTAAAATGCGTAATCTTGATCAT
TTTTAGGAGGGCATACCATAGGGATGTCTCATTGCTCGTCATTCGATAGCCGTCTCTACAACTTCACTGGGATAGGCGATACTGACCCCTCAATGGACCCAAACTACATTGCAAGATTAA
AGTTGAAATGCAAACAAGGAGACCAAACCACTTTAGCTGA
GTTAGACCCTGGGAGCTCACTACTACAGAAATAGGCATTTGCGACGGCCAAATCCGTAGCAAATCCATAGCAAACACCCT
TTTTGCTACGAATTTGCTACGGATTTGGTTCGTAGCTACAAGTCCCGTCGCGAATTTATTTGCTACGAACTTTAGCTACGGAAATTATGTTTGCGATGAATTTAGCTACAAAAAATGTCG
TCGGTATTTTAGCCACGAATTTGCTACGAACAAGGTTGCTACGAAATTTCGCTATGGTTTTTTAGCTACGGATGTTTTTAGCTACGGAAACTTTAGCTACGGTTGTTTTTAGCTACGGAT
ACTTGTAGCTACGCAACATTTTAGCTATGGTTATTTTTTAGCTACAGAACTTTGCTACCATTTTTTGCTACAGATTATTAGCTACAGAGTCTTTTTGCTATGGATTTTAGCTACGGTTTT
TTAGTTACGAAACTTTGCTACCATTTTTATATTAAAATATATCCAAATTCACATAAAGATTTACAATCACAAATAAAACCTGAGTTTCTACAATTTGATAAAAATTATAAGATATATACA
ACGCAATAAAATATCATAAAATTCTACAATTATTGGAATACAACTTCTATATCTAAATGAAGAAAACAACACTACTTCATGCCATCAAGAACACAACTTCTTATGAATGCAACATAGAAT
ATAATGTTTATAAACAGCACCGCTTTTTCTTGATCTTCATCATTTCAAGAACCTTCATTGCCATCTTTTCTAATCAAATGCTTCAAAGCACATGCATTTTAGAGATTCGAACCTGAGCAA
AGACATAATTTAAATTTATTAGTGTAATATAGGGGAATAACATTTGGTGTTCAAAAAAATGCTTCGAAGCAAATTATATGTCCAAGCATATACACCTTTGGCTCACAATAACTAATTTGT
TTAGTTGTGAGCCTGCGAAGCATTAAGAACCATCCAAAATCTCAAAACCATCTTGTACAAATGGTTGAGAACAAAAACACGAGAGTATAAAAAATATATATTTAAATGGGATTCGTACTT
AAATAATGCAATGTGCACCTGGGACTTAAAAAACACATATTAGTGGTAATGATGATTAATTATGAAGAGAGATTATAAAAATGAAATGATCGCATACCCCGTGACGCCGTAGTATGAATG
AGAATTTAGTTTGGGGATGAATTAAGAAAATAAGTGTATTTTGGAAGAAAGAAACTTGAAAGATCGAGCTCGGGCTCGTTAAGGCTCGACTCGTTCGAGCTTTTAACCGAGTCGATCACG
AGTAGCTCTCGAGCCTCTGGGCTTGTTTACACCCTTAACTACAATAATAAATACTCTGTGAGTTAATTGACTATGTGCCTACACAACACTGATGCATTCTTCTTTATGGCCACCTCTGAA
TAACTATAGAGAGTGACTTTTTTACCCCTATGACAAACGAAACACAGAAACAAACACTACAGAAAAAAAAAGTTCAAATCTTTTAACTGTGTATTTGCAATTTATAACCAGAAACCTAGA
AGGAATACATTAAATCGTTTAAATTTTCAACGCTAAAATTACACACAACCAAATTGATACATAAATGTTAATCCATCATCTTCCTGTCAAATGCAAATTAACAAATAAAACAAATTCAAT
TTAAAACCTAACAACATATTTTGAAATGAGCTCAAAAAAACCAATTTCTCCAATTCTATTGCCGTCATCAAAATTCCGTCAAAGAACAGTCTCTCATTCTCCCTTTATGTATGAAAACCT
TTCTTACTCTCCAAGTGTATCCCTAAAAATTACCAACCTAACACAAATGACCGACACAAATTTCGGATTCGAGTAAAAGGATTGATGATACCTGATGAAACAGCAGTGGCGGTGAAGACG
TTGTCCGATTGAGGTTGGCTGGAATGAGATGTTGGTCGCCGGACGGAACTAGAAGGTTGGCCGGCGGCTGGAACAAGAACGTCGGCGAGTTTAAGGGTGCGACCGTGGGCTGGAATGTGT
GTTTTTTAGGATTGAGGGGGTATACAAGTAGTACAGGAAGTCAAAATTAAATTATACCAATTTAACAAATCTATCGAATTATACTTAGATCTGTGATTTAAAAAAATAGGAAATAAAATT
GTTAAATAAACGTCTTTAAGAATCTATGCAAAATTATATGAGTAATTTATTAATATTACATACATATCTAAGTATTTATACATATTACGTATGTATATAATATTAATAAATTAATGAATT
GTGGGAGTCGGTAGGAGTCGGTTCAAGTTTTTACCCAAATACCCAACTACCCGATTTCAACAAGGACAGGAACCGAGTTTTAGACGTGGGTTTTTTTCGGGTAGTGTACGTAGGTGAGGT
CGGGTATCGGTTTGGGTCGGTTCTTGCTCGGGTCGGGTCGGGTTTTGATTTTTCTCACCCCTAGAAGAAATAGATCGAAAGAAATTGGAAGTGTACCTGAGTCACAAGAAATTAGACCTT
GGAAATTAAAATTGAAGGTCGTGATTCCGGTGGAGTGGGCGGCGATGGTCGTGAACGGTGGTAGAGTAACTGGTTGCATATGAGAAAACCCTATTTTGGGGTTTAAGCTTTATTTACATC
CAACTTTCTACAATTTTGCTACCAAGTTTATTTAACTTTTTTATTTAATTTTCAAACATTTCTTTTTGCTACTGATTTTGCGACGTTATTTTTTTATATTTTTTTCCTCAGATTTGCTAC
GGATGTTGCTACAACTTTTTTCTACGCTTGGTTTTAATTTTTTTTTTTTTTGATAAATTTTGCTACGAATTTTGCTAGGCTTTTTATTTAATTATTTTTTAGATACTTATATTCTCAACT
TTGCTACAGATTTTGCTACTGGTTTTATTTAATTGATTTTTAGTTAATTTATAAGTATGTATTTTCTTGGTTTTGCTACGGATTTTGCTATGTTAGTTTTTAAGAATTTTTCTATATTTT
GCTACCAATTTCTCTGCAGACTCAATTTACTTACCGATTTTGCTACCATTCTTATTAAACCTCAGTTAGTTAGTTTTTAATATTTATTTTTATGATTTAGCTATGGACTTTGCTACCAAT
TTTACTAAGTTTTTTTATTAAATTTATTTTCACAATTTTGCTATCGATTTTGCTAGAAATTTTATTTTACTTTTTTTAGTTTATTTCTTAATACTTATTTTCATGGTTTTGCTACCGGTT
TTGCTACAATATATGATTTATATTAATTTCATCAATTAATTTGCTACGGATTTGCTATGAGTTTTGCTACAAAATTCATTTGCGACGGAAGTTCGTAGCTAATCCGTAGCTAATTCGTAG
CAAAATGTGCTCGTAGCTAATCCGTAGCAAACTCGTAGCAAAATTTGCCACCATTTTTTTCTGTAGCAAAATTTCATAGCAAATGCCTCTTTTTGTAGTAGTGGCTTCAAGACATTTGAT
GACTCTTACTACAGACTAGTGACTAAGAGGAGAGGACTTCTACAATCAGATGCAGCCTTGCTTAACGACCCTGAGACTAGAGCGTACTTGGTTCAATCTACTAGCCATGGTTCCACTTTC
TTCACGGATTTTGGTGTGTCTATGGTTAAAATGGGTCGTATTGGGGTTCTTACTGGCTCTCAGGGTGAAGTCAGGAAAGTGTGTTCCAAAAGGAACTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCACTTACAAAAACTCATTTGGATATTTTGTGCTTCCAGTTATGGTTCTAGCATTCTTAACTCTCCAAGCAGAAGGCCAAGGCTTAAAAGTTGGGTTCTATGAGAAATCATGCCCA
CATGCTGAAAAGATCGTAACTACGGTCATCAATGAAGTTATGGCAGTCGCCCCGTCACTTTCTGGCCCATTGTTGAGAATGCATTTCCACGACTGCTACATTCGG
GGTTGTGATGGTTCA
GTTTTATTGGACTCTCCAACAAATCAATCCGAGAAATTTGCACCCCCGAATCTCAGCCTGAGAGGGTTTAATATCGTTGATAGAGTGAAGTTGGCGTTAGAAAATGCCTGTCCAGGTGTA
GTTTCTTGTGCTGACATCGTAGCCCTTGTTGCCAGAGACGTTACTGTGGCG
ACCAAGGGACCATTTTGGGAGGTCGAAACTGGCCGAAGAGACGGAAATGTGTCTTTAATCAGTGATCCC
ATAAATCCAGCAACAGGATTACCGCCATTTTTTGCAAGTATTAATCTTTTGAAACAATCATTTGCACTGAGGGGACTAAACACAAAAGATCTTGTGGTTCTCTCTG
GAGGGCATACCATA
GGGATGTCTCATTGCTCGTCATTCGATAGCCGTCTCTACAACTTCACTGGGATAGGCGATACTGACCCCTCAATGGACCCAAACTACATTGCAAGATTAAAGTTGAAATGCAAACAAGGA
GACCAAACCACTTTAGCTGA
TGGCTTCAAGACATTTGATGACTCTTACTACAGACTAGTGACTAAGAGGAGAGGACTTCTACAATCAGATGCAGCCTTGCTTAACGACCCTGAGACTAGA
GCGTACTTGGTTCAATCTACTAGCCATGGTTCCACTTTCTTCACGGATTTTGGTGTGTCTATGGTTAAAATGGGTCGTATTGGGGTTCTTACTGGCTCTCAGGGTGAAGTCAGGAAAGTG
TGTTCCAAAAGGAACTAA

Retrieve as FASTA