Entry information : HaPrx40 (HanXRQChr10g0286351.3)
Entry ID 13594
Creation 2016-05-02 (Christophe Dunand)
Last sequence changes 2016-05-02 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2017-11-23 (Catherine Mathe (Scipio))
Peroxidase information: HaPrx40 (HanXRQChr10g0286351.3)
Name (synonym) HaPrx40 (HanXRQChr10g0286351.3)
Class Class III peroxidase    [Orthogroup: Prx011]
Taxonomy Eukaryota Viridiplantae Streptophyta Asteraceae Helianthus
Organism Helianthus annuus (Sunflower)    [TaxId: 4232 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HaPrx40
start..stop
S start..stop
HaPrx71 603 0 70..363 28..321
HaPrx132 540 0 75..363 33..321
HaPrx59 538 0 75..363 33..321
HaPrx[P]70 537 0 75..363 33..321
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 46211980..46212187 208 N° 2 46209486..46209625 140 N° 3 46208622..46208816 195 N° 4 46207885..46208433 549
complement(join(46207885..46208433,46208622..46208816,46209486..46209625,4621198 0..46212187))


exon

Literature and cross-references HaPrx40 (HanXRQChr10g0286351.3)
DNA ref. HanXRQ genome:   HanXRQChr10 (46212187..46207885)
Protein sequence: HaPrx40 (HanXRQChr10g0286351.3)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   363
PWM (Da):   %s   39841.75  
PI (pH):   %s   4.67
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
METVRGNEVFKWQWSRQPESEEELKEWKECCEVLSLVKVSISKDAWIWGGDSQNGFSVKSVKSDLIKERGLSSHYYDRICPEALPTIKRVVEDALAQEQRMGASLLRLHFHDCFVGCDGSILLDQTPTIDSEKNAAPNANSARGFEVIDKIKDEVDKVCGCPVVSCADILAVAARDSVVALGGPSWKVRLGRRDSTTASQSAANANIPTPSMNLPALIKNFEDQGLDEEDLVVLSGAHTLGFAQCRNFRDRIYNETNIDPAFASHLQTICPQVGGDSRLAPLDPTPNSFDVKYFSSLASKKGLLSSDQALLDGGETAELVLKYSGDAEEFWEDFAESMIKMGDIKPLTGNRGEIRNDCRKVN*

Retrieve as FASTA  
Remarks
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGAAACGGTAAGAGGAAATGAAGTGTTCAAGTGGCAGTGGTCTAGGCAGCCAGAGTCTGAAGAGGAGCTCAAGGAATGGAAGGAATGTTGCGAGGTTCTTAGTTTGGTGAAAGTTTCC
ATTAGTAAGGATGCTTGGATTTGGGGTGGAGATAGTCAGAACGGATTCTCGGTTAAGTCTGTCAAATCAGACTTGATTAAGGAGAGAG
GTAACTGTCACCCGCCAATTTTTGTTTGGTGC
AGATGGGTTCCTATTAAATGCAATATTATGAACTAGAGAGGCAATCTGGATAGGCTGCCTACTAGAATAAATTTAAGAAGAAGGAATGTGGACATATCCTCATCTAGGTGCCCATTCTGC
GAGGACGCCGAGGAATCGGTCGAGCATCTATTCACTGCTTGTTCGATTGCGTTGAGGGTGTGGTCGGCTTTCAGCGATTGGTGCAACATCCCGCCGATCTACCTTTTTGAATTTAAAGAT
ATTTTTGATATCCACAAATCCATTAAGCGTAGTAAGAAGGAGGAGAAGATATTTATGGGTTGGCTCTGATAACGTCTTGGTGCATATGGAAAGAAAGGAATGAAGTGGTGTTTAAACAGA
AAAGATGTAGTTCGCAAGACATCATTGGGGAGGTAAAATCTAGAAGTTTCGCTTGGGTTAAAAATAGATCTTCTTGTAAGTATATTAGATGGTCGGAATGGTGTAAATACCCTATGTATA
TGTTGTAATTTCCTTGCCCTTTGCCCGTTTGGGTCGGGGGTGTTGTTTTGTGTTTGGCCTTTTGCCCGTTTGAGTCGGAGGTGGTTTTAATGAAGTTTAATTTTCAAAAAAAAAAAAAAA
AAAACTTAAAGTAGACTTTATTTTATTCCACAACGTGCATTTTTCTAATATACTTAAAGCCCCAGGCCACCACACTGAGGCTATGACCCTATGGTAGATGGAAAACTATCCAAGTGCATT
TTAAATTGATAAAGCCAAAATACCAAAATACCCTTACTTATAAATGTAAAATTTCAAACATACCTCTCATTAAATGGTGTTTTTTTAACTAAGTTAATCATTTGAATGAAAATGGCAAAA
AATGCCAAACGTGGGGGGGCAAAATGGTACAAAAATATCATTTTGGACGAAAATGACAAACGTGTCCAAACCTCAGGGACGATTTTGGCAATTAACTCTTTTTTTTCACGAATTATCATC
AAATATATCATTTTGATAAAAAAAAAATCAAAGTTTTAAACATCATTTAACAATATGATACGATAATATTCAAAAGTCTTAAAACTTAATGTTTCACATACAAACGATTCCAAATCAAAT
CGCATCTATAAAAAAAAGACAAATAATGTTTGGGTTTTTATTCGTCTTTCGAGTTTAGGGTTTTTTGGGTCGGATTATCAGAGTTTTTGCTTGGGAAAAGTGACCCGATAACCGACCCAT
TTAAAGTTTGGGTTGGTCGGGTTTGGGTTATTCAGGTTCGGGTGACTTCAAATTCGAGTCGAGTTTCGATTTCAGATAAAAAAAGACAACCTTATCGATATATTTACAAGTTTAAGTATG
ACAAATTCTTTTGGGATATCAATAATATTTTTTATATCTAATAACAAATTAATCGTCATCATACTCACTAAATTCCACCAATAGCAAAACTAAGGTAGGGTCTGAGGAAAGTAAGATGTA
AACAATTTTACCTCTATCCTGTTGAAATAGAGAGACTGCTTCCAATGACACCCCCGGCTCGATAGTAGTTTGGCATCAAACCTTGCACATAAGGCACATAACACTTGGCAAATAAGACAA
ATGTCAATTAGTGCATGTACTCCCTTGTCTTTCGACTATCAGCGCAACACATGATGCATCATTAACCATCCCCTCTTTTATTATTTTCATGAAATTAGTAAAATAACATTAAAATTAGTA
CAATTTCACTCTTTACCCCCAAACACCCACACATATATAGATTATATATACATCCACCAAATACATCAATTGATTTTTTTTTTATCTTATGGGTAATCAAAAAGTATGGTTTTTTTTTTT
TATTATTATTACTAGCCAAGTCAAAACCTACCTTTATTTTTATATCTTTTTCATTACTTGGGGACTAGGGGATTATGCTATCTACCAAGTCTTACATATGTTTCTAGAGCTCATATAACG
AAAATATCAAAGTAACTCGAATTAATATATCTTATGTATAACTTCTGGGATTGAGATATCTACCCAAAAAAATAATTAATATAGTAATTTTAATATCGAATAACTCAAATATTTAACGAG
TTCTAGAATTATATAACCAAGTCCCCTACATTGTTTAGTGCAAGTATACTAATACAAACATTAGCTTTTGTCTTTGACCATTTCTAAATTAATCCAACCATCTCTTACCTTTGCGATCCT
TATAAATACAGCACATAAGACTGCAACAACAATACACAACACAAACAATTTCTACTAAAAAGCACATTTGGCCATCATTTATGGAGAAGATGAACATCAGAAGTTTATTATATCTTTTTG
TTTCTCTCATTTCTTGTATTGCCACCGCATCCTCAAACTCAGGTTTGTCATCACATTATTATGATCGCATATGCCCTGAAGCTCTTCCGACCATCAAACGTGTGGTGGAGGATGCATTGG
CACAAGAGCAACGCATGGGTGCATCTCTATTACGTCTGCATTTTCATGATTGTTTTGTTAAT
GTAAGTAATTTATTCCTACAAATTTATATTTGAGATTTCATACTTGGATATTCGGAGC
AAAGACATATTTTTTTTTTTGCCATCGAAACGCCTAAGAATTAAAGTATTACAAATTAAGTTTTGTTAAGTTTATATTATGATTGTTTTGTTAATGCTTGTTGAACTAATACATTTAGTT
TAGTCTTACAAATTAAGTTTAGAAAACGATTAAAAGCAAGTATCCTAAGAATTAAAGTATTCAAACTTGATAAAAACTAAAGCAGTTTTGCATGTTATTAAAGTTCAATGCAAGCATTTT
TCTTAAAGTTCTTCTCTCCATGTAAACAGTAAAAATATTTGTTTGTTATTTGATTAAACATGTAACTTCCACATATAAATTGTGCTTTAACATTCATGATTTACAATAAATTGGTACTTG
AATTTAACTATAGATGCTTAATAAATATAGAAATCAAAAACTTTTATCATGATTTAGAAATAAAAGTTTTATTTTCTTACGTAAAATATACTTTCCGTTATACTTAATGACGCACACTTG
AAAGGGAAGAACAAGGCGCTGCAAAATGAAGTGTTATCTTGTAGAATATAAGGGAGTAGAAAGTGTTGGTGTTGTTTTATGAATAGAAAGTGATGGTGTTGTTTTTTGAGTATATTTTTT
TAATCTTGTAGGGATGTGATGGTTCCATTCTTTTGGATCAAACACCTACAATAGACAGCGAGAAAAATGCAGCTCCGAACGCAAATTCAGCTAGAGGATTCGAGGTTATTGACAAAATCA
AGGATGAGGTCGACAAAGTTTGTGGCTGCCCGGTGGTGTCATGTGCAGATATCTTAGCTGTTGCCGCTCGTGATTCTGTTGTTGCG
GTAAGTGATTGCGATTGTTAACATACACCTAGAG
AGTAAAAATTCTCACTTTCATGGAGTTGAAAAAAAATCATGAATGTGTCCCTCTTTAACAAATTTTTGTAATGATGAAAACAAATAAAAGAAATAAAATTTTAGCGTGACAAACATATTA
TTTGTGTAAATCTAAATCTTTTTATGGTTTGCAGCTTGGTGGCCCATCATGGAAAGTCAGGCTCGGAAGAAGAGACTCAACCACCGCTAGCCAAAGCGCAGCTAACGCTAACATCCCGAC
ACCGTCCATGAACTTACCTGCCCTTATAAAAAACTTTGAGGACCAAGGGCTCGACGAGGAGGACTTAGTTGTGCTTTCAGGAGCACACACCTTAGGGTTTGCTCAGTGTCGAAACTTTAG
GGATCGTATTTACAACGAGACCAACATTGATCCAGCCTTCGCGAGCCACCTTCAGACCATTTGTCCACAAGTTGGGGGCGACTCAAGGCTCGCACCACTTGACCCGACACCAAACTCGTT
TGATGTGAAATACTTTTCCAGTTTGGCGAGTAAAAAAGGACTTTTGAGCTCTGATCAAGCACTCTTGGATGGTGGTGAAACTGCTGAACTTGTTTTGAAATACAGTGGGGACGCCGAAGA
GTTCTGGGAGGATTTTGCAGAGTCTATGATTAAAATGGGTGATATAAAGCCATTAACAGGGAATAGAGGTGAAATTCGCAACGATTGTAGAAAAGTTAATTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGAAACGGTAAGAGGAAATGAAGTGTTCAAGTGGCAGTGGTCTAGGCAGCCAGAGTCTGAAGAGGAGCTCAAGGAATGGAAGGAATGTTGCGAGGTTCTTAGTTTGGTGAAAGTTTCC
ATTAGTAAGGATGCTTGGATTTGGGGTGGAGATAGTCAGAACGGATTCTCGGTTAAGTCTGTCAAATCAGACTTGATTAAGGAGAGAG
GTTTGTCATCACATTATTATGATCGCATATGC
CCTGAAGCTCTTCCGACCATCAAACGTGTGGTGGAGGATGCATTGGCACAAGAGCAACGCATGGGTGCATCTCTATTACGTCTGCATTTTCATGATTGTTTTGTTAAT
GGATGTGATGGT
TCCATTCTTTTGGATCAAACACCTACAATAGACAGCGAGAAAAATGCAGCTCCGAACGCAAATTCAGCTAGAGGATTCGAGGTTATTGACAAAATCAAGGATGAGGTCGACAAAGTTTGT
GGCTGCCCGGTGGTGTCATGTGCAGATATCTTAGCTGTTGCCGCTCGTGATTCTGTTGTTGCG
CTTGGTGGCCCATCATGGAAAGTCAGGCTCGGAAGAAGAGACTCAACCACCGCTAGC
CAAAGCGCAGCTAACGCTAACATCCCGACACCGTCCATGAACTTACCTGCCCTTATAAAAAACTTTGAGGACCAAGGGCTCGACGAGGAGGACTTAGTTGTGCTTTCAGGAGCACACACC
TTAGGGTTTGCTCAGTGTCGAAACTTTAGGGATCGTATTTACAACGAGACCAACATTGATCCAGCCTTCGCGAGCCACCTTCAGACCATTTGTCCACAAGTTGGGGGCGACTCAAGGCTC
GCACCACTTGACCCGACACCAAACTCGTTTGATGTGAAATACTTTTCCAGTTTGGCGAGTAAAAAAGGACTTTTGAGCTCTGATCAAGCACTCTTGGATGGTGGTGAAACTGCTGAACTT
GTTTTGAAATACAGTGGGGACGCCGAAGAGTTCTGGGAGGATTTTGCAGAGTCTATGATTAAAATGGGTGATATAAAGCCATTAACAGGGAATAGAGGTGAAATTCGCAACGATTGTAGA
AAAGTTAATTAA

Retrieve as FASTA