Entry information : HaPrx46 (HanXRQChr04g0105061)
Entry ID 13600
Creation 2016-05-02 (Christophe Dunand)
Last sequence changes 2016-05-02 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2017-11-23 (Catherine Mathe (Scipio))
Peroxidase information: HaPrx46 (HanXRQChr04g0105061)
Name (synonym) HaPrx46 (HanXRQChr04g0105061)
Class Class III peroxidase    [Orthogroup: Prx007]
Taxonomy Eukaryota Viridiplantae Streptophyta Asteraceae Helianthus
Organism Helianthus annuus (Sunflower)    [TaxId: 4232 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HaPrx46
start..stop
S start..stop
HaPrx[P]47 618 0 1..327 1..329
HaPrx92 585 0 1..327 2..328
LsaPrx12 540 0 1..327 1..327
HaPrx20 498 2e-179 1..327 1..330
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 53124395..53124796 402 N° 2 53123989..53124151 163 N° 3 53123482..53123900 419  
complement(join(53123482..53123900,53123989..53124151,53124395..53124796))


exon

Literature and cross-references HaPrx46 (HanXRQChr04g0105061)
DNA ref. HanXRQ genome:   HanXRQChr04 (53124796..53123482)
Protein sequence: HaPrx46 (HanXRQChr04g0105061)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   327 (301)
PWM (Da):   %s   35025.89 (32271.3) Transmb domain:   %s   i12-34o
PI (pH):   %s   8.58 (8.40) Peptide Signal:   %s   cut: 27 range:27-327
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MEALSPNRKHTLLVVLLATLITLAVGQGTRLGFYRTSCPRVESIVQSAVQSAIRSNPAMAPGLLRMFFHDCFVNGCDASILLDSSSSEKTAPPNSLLRGFEVIDAAKTQLETACPGVVSCADILALAARDSVVQTGGTGWPVPLGRRDGLVSRAADTANLPAFNDPVSVQVRKFTDKGLNTQDLVALSGAHTIGTAACALFSYRLYNFNNTNGPDPTIDTAFLPTLRNLCPNGGDGSRRVDLDTGSVGRFDNSYYSNLRNRRGVLESDAALWNDPTTQRFLNRFLGVRGLLGLTFNVEFGRSMIKMGNIEVKTGTQGEIRRVCTATN

Retrieve as FASTA  
Remarks
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGAGGCTCTTTCTCCTAACAGAAAACATACGTTGTTGGTTGTATTGTTAGCCACCTTAATAACCTTAGCAGTTGGCCAAGGCACACGACTTGGGTTCTACCGGACCTCATGCCCAAGG
GTGGAATCCATCGTGCAGTCTGCGGTCCAGTCTGCTATCCGCTCCAACCCTGCCATGGCACCCGGTTTACTAAGAATGTTCTTTCACGATTGCTTTGTTAATGGCTGCGACGCCTCTATT
CTACTCGACAGTTCATCTTCTGAAAAAACCGCCCCCCCAAACTCGTTGTTGAGAGGCTTTGAAGTCATTGATGCCGCAAAGACACAGCTGGAAACCGCGTGTCCTGGGGTGGTTTCTTGT
GCTGATATTCTTGCCCTCGCTGCCCGTGATTCTGTGGTCCAG
GTATTGAAAGAATTAAAGAAAACTAAATTGGTGAATAATATTTTTTTGTGTAGAGTATAATAAAAAAGATGTTACTAA
AGACAGATTATAGTGAAAAAGATAATATTAAAGCTATCAAACTAATTAATAATAAAATGATGGTAACTATATATTCAAACAGCTGGTGACTCTATTTGCATGTTTACTAACTCAATAGTA
ATTTCATGATGAACGTGAACTTATTTAACTTTGATGACCTTGCAGACCGGAGGAACGGGCTGGCCGGTGCCATTAGGTCGGAGAGATGGATTAGTTTCTCGTGCAGCGGATACCGCGAAC
CTGCCAGCTTTTAACGACCCGGTTAGTGTCCAAGTCAGGAAGTTTACTGACAAGGGTCTTAACACCCAAGATCTTGTTGCCCTTAGTG
GTAAGTTAAACACAAAGAATATTGTAATCATC
TATGCCCATATCAAAACAAAATGAACACACATGCTAATAAAGTTGCTGATTTTCAGGAGCACATACAATCGGGACAGCAGCATGCGCGTTATTTAGCTACAGGCTATACAACTTCAACAA
CACGAATGGACCTGACCCGACTATTGACACAGCATTCCTTCCCACACTCCGAAACCTATGCCCCAATGGTGGTGATGGTTCAAGACGTGTCGATTTAGACACAGGCAGTGTTGGCAGGTT
CGACAACTCATACTACTCAAACTTGAGGAACAGGCGGGGAGTGCTTGAATCCGATGCTGCTTTATGGAATGACCCGACAACACAAAGGTTTCTGAACCGGTTTCTTGGAGTTAGGGGACT
GCTTGGATTGACATTCAATGTTGAGTTCGGGAGATCGATGATTAAGATGGGTAATATTGAGGTGAAAACCGGTACCCAAGGCGAAATTCGCAGGGTTTGCACTGCTACCAATTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGAGGCTCTTTCTCCTAACAGAAAACATACGTTGTTGGTTGTATTGTTAGCCACCTTAATAACCTTAGCAGTTGGCCAAGGCACACGACTTGGGTTCTACCGGACCTCATGCCCAAGG
GTGGAATCCATCGTGCAGTCTGCGGTCCAGTCTGCTATCCGCTCCAACCCTGCCATGGCACCCGGTTTACTAAGAATGTTCTTTCACGATTGCTTTGTTAATGGCTGCGACGCCTCTATT
CTACTCGACAGTTCATCTTCTGAAAAAACCGCCCCCCCAAACTCGTTGTTGAGAGGCTTTGAAGTCATTGATGCCGCAAAGACACAGCTGGAAACCGCGTGTCCTGGGGTGGTTTCTTGT
GCTGATATTCTTGCCCTCGCTGCCCGTGATTCTGTGGTCCAG
ACCGGAGGAACGGGCTGGCCGGTGCCATTAGGTCGGAGAGATGGATTAGTTTCTCGTGCAGCGGATACCGCGAACCTG
CCAGCTTTTAACGACCCGGTTAGTGTCCAAGTCAGGAAGTTTACTGACAAGGGTCTTAACACCCAAGATCTTGTTGCCCTTAGTG
GAGCACATACAATCGGGACAGCAGCATGCGCGTTA
TTTAGCTACAGGCTATACAACTTCAACAACACGAATGGACCTGACCCGACTATTGACACAGCATTCCTTCCCACACTCCGAAACCTATGCCCCAATGGTGGTGATGGTTCAAGACGTGTC
GATTTAGACACAGGCAGTGTTGGCAGGTTCGACAACTCATACTACTCAAACTTGAGGAACAGGCGGGGAGTGCTTGAATCCGATGCTGCTTTATGGAATGACCCGACAACACAAAGGTTT
CTGAACCGGTTTCTTGGAGTTAGGGGACTGCTTGGATTGACATTCAATGTTGAGTTCGGGAGATCGATGATTAAGATGGGTAATATTGAGGTGAAAACCGGTACCCAAGGCGAAATTCGC
AGGGTTTGCACTGCTACCAATTGA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TATCCAATAC TTGTTTAGAA ACACCAAACA AATCTTTGTA GCAATGGAGG CTCTTTCTCC TAACAGAAAA CATACGTTGT TGGTTGTATT GTTAGCCACC TTAATAACCT TAGCAGTTGG  CCAAGGCACA CGACTTGGGT TCTACCGGAC CTCATGCCCA AGGGTGGAAT CCATCGTGCA GTCTGCGGTC CAGTCTGCTA TCCGCTCCAA CCCTGCCATG GCACCCGGTT TACTAAGAAT  GTTCTTTCAC GATTGCTTTG TTAATGGCTG CGACGCCTCT ATTCTACTCG ACAGTTCATC TTCTGAAAAA ACCGCCCCCC CAAACTCGTT GTTGAGAGGC TTTGAAGTCA TTGATGCCGC  AAAGACACAG CTGGAAACCG CGTGTCCTGG GGTGGTTTCT TGTGCTGATA TTCTTGCCCT CGCTGCCCGT GATTCTGTGG TCCAGACCGG AGGAACGGGC TGGCCGGTGC CATTAGGTCG  GAGAGATGGA TTAGTTTCTC GTGCAGCGGA TACCGCGAAC CTGCCAGCTT TTAACGACCC GGTTAGTGTC CAAGTCAGGA AGTTTACTGA CAAGGGTCTT AACACCCAAG ATCTTGTTGC  CCTTAGTGGA GCACATACAA TCGGGACAGC AGCATGCGCG TTATTTAGCT ACAGGCTATA CAACTTCAAC AACACGAATG GACCTGACCC GACTATTGAC ACAGCATTCC TTCCCACACT  CCGAAACCTA TGCCCCAATG GTGGTGATGG TTCAAGACGT GTCGATTTAG ACACAGGCAG TGTTGGCAGG TTCGACAACT CATACTACTC AAACTTGAGG AACAGGCGGG GAGTGCTTGA  ATCCGATGCT GCTTTATGGA ATGACCCGAC AACACAAAGG TTTCTGAACC GGTTTCTTGG AGTTAGGGGA CTGCTTGGAT TGACATTCAA TGTTGAGTTC GGGAGATCGA TGATTAAGAT  GGGTAATATT GAGGTGAAAA CCGGTACCCA AGGCGAAATT CGCAGGGTTT GCACTGCTAC CAATTGATCG TGGAGTATCG AAGATTGGTT TCGAATGATT TATGAAGATA CAAGCTGTTC  ATACAATCAT TATGTGGCTA GGAACAAGAT TATAAAAAAA CTGTTATTAA TTTCTGTAGT TTGTATTTTT TTTTTTTTTT CAATAGTTAT GTGCATGTTA TGTTGTATTT ATGATAATCA 
TTTATCAATT AGAGGAGCCT AAAAAGTTGG CAATGGTAAC GTTAATTGTG TAGAAACTGT AGTTATTGTT TTAAAGTTTT TTTTAATTTA ATATGTTACA TCAACTTTGT TGTGA 

Retrieve as FASTA