Entry information : HaPrx49 (HanXRQChr04g0111511)
Entry ID 13603
Creation 2016-05-02 (Christophe Dunand)
Last sequence changes 2016-05-02 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2017-11-23 (Catherine Mathe (Scipio))
Peroxidase information: HaPrx49 (HanXRQChr04g0111511)
Name (synonym) HaPrx49 (HanXRQChr04g0111511)
Class Class III peroxidase    [Orthogroup: Prx015]
Taxonomy Eukaryota Viridiplantae Streptophyta Asteraceae Helianthus
Organism Helianthus annuus (Sunflower)    [TaxId: 4232 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HaPrx49
start..stop
S start..stop
LsaPrx10 548 0 10..331 6..324
LperPrx10 523 0 10..318 6..311
LvPrx10 463 2e-166 10..280 6..273
StPrx23 464 5e-166 7..330 3..324
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 106501439..106501666 228 N° 2 106501753..106501944 192 N° 3 106502039..106502201 163 N° 4 106502773..106503185 413
join(106501439..106501666,106501753..106501944,106502039..106502201,106502773..1 06503185)


exon

Literature and cross-references HaPrx49 (HanXRQChr04g0111511)
DNA ref. HanXRQ genome:   HanXRQChr04 (106501439..106503185)
Protein sequence: HaPrx49 (HanXRQChr04g0111511)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   331 (304)
PWM (Da):   %s   35513.94 (32515.3)  
PI (pH):   %s   8.32 (8.21) Peptide Signal:   %s   cut: 28 range:28-331
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSPMIMARILTIITLVSLQCFVTLVHSKAQVQIGFYSDSCSAAESIVKQEVSKAYSEDRGLAAGLVRLHFHDCFVRGCDASVLIDSTPSNQAEKDSPANNPSVRGFNVIDSAKARLEASCPGIVSCADIIAFAARDSFEITGGLGYEVPAGRRDGRVSLIADTRALPPATSNLAQLTKSFSTNGLTQEEMVTLSGAHTIGRSHCTAFASRLYNFSSTVNLDPSLNPLYASKLKQECPKGSNNVNLVVPMNPSSPTISDTGYYVDVLNNRGLFTSDQSLLTSQSTLNQVHQHAMNPLVWKIKFAKAMVKMGRIGVITGQQGEIRSNCRVINK

Retrieve as FASTA  
Remarks
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGTCCCATGATCATGGCTCGTATTCTTACAATTATAACTTTGGTTTCATTACAATGTTTTGTAACTTTGGTTCATTCAAAAGCCCAAGTTCAAATCGGGTTCTATTCGGACTCATGT
TCTGCGGCTGAATCTATTGTCAAACAGGAAGTGAGTAAAGCCTACTCGGAAGACAGGGGTCTTGCTGCCGGTCTCGTGAGACTGCATTTTCACGATTGTTTTGTGAGG
GTAAGTTTGGTT
CAAGTTGTAGGTTATAACGGGCTGAAATCAAAATGGCTCCGGTCTTTATACTAACAATGGTTTGTTCGTAACAGGGTTGTGATGCATCGGTCTTAATAGATTCGACTCCTTCAAACCAAG
CGGAGAAAGATTCACCTGCAAATAATCCAAGTGTACGTGGATTTAACGTCATTGATAGCGCTAAAGCCAGACTCGAAGCCTCATGTCCGGGAATTGTTTCTTGTGCTGATATAATTGCAT
TTGCAGCTAGAGATAGCTTTGAAATA
GTAAAGATAAATGAAAACTTATGACACAAAGGCCCAGTCAATTGGACCGGGCTTTACGAGTGTATAATCGTGTGTATAATTGTTGTTATTGCAG

ACTGGTGGACTGGGGTATGAAGTCCCTGCAGGGAGAAGAGATGGCAGAGTATCACTGATCGCAGACACGAGAGCATTGCCTCCGGCAACATCTAATCTTGCCCAACTCACTAAGTCGTTT
TCAACCAATGGGTTGACCCAAGAAGAAATGGTTACTCTATCCG
GTAAAGCGGTTGATAACAAGATTTTGATTAGATAAAGGGATAATATGTACATAGGCACACATTTGAGTCAAATTAAC
GAATAAGTTTTGATAAACATGTCCCGGTAAGATTGACCTAACTTGTCAACCCGCTTTTTCTGTATTAATAAAAAACATTTTTAACGACAAAAATTAAAACCAGATTTGAGTTTTATGTCA
AAATTTAAGAAGAGAAATTAGCATTATTTTTATAATTGAAAGTTGAAGATTTTATAGATAATTGTACTTTTTTATGTTGTTGTAAACTGTAGTTTAGAGCATTTATATGCAAAAAAAAGT
GTAAAAACGAAAAAAGTTTAGAAGGACCACCACGACGGCACGACCCCATAGGCAACCCAAGTATTCAAAAAGTTTTCATCAAGGTCACTTAACTAACAAAACAATTTTAAAGGTCCATTT
GATTTTGTTTTGTCAAGTTCGTGTTGATTAACTTAACCTCACACGTTTCAACCCACACCCTAATTTACTTATCCTAACATGTTACCCAACCTAAACATTATACACCTCTAAAATCTTGAA
TCGGTGAATTACAGGAGCACATACTATTGGCCGATCACACTGTACAGCCTTTGCTAGCAGGCTATACAATTTCAGCTCCACCGTAAACCTGGACCCGAGTTTGAACCCGTTATATGCTAG
CAAGCTAAAACAAGAATGCCCAAAGGGGAGTAACAACGTGAATTTGGTTGTACCCATGAACCCTAGCTCACCAACCATAAGTGACACAGGTTACTATGTAGACGTCTTGAATAACAGAGG
ACTATTCACATCAGACCAGTCTCTACTCACGAGCCAATCGACATTAAACCAAGTGCACCAGCATGCTATGAACCCGCTGGTTTGGAAGATTAAATTTGCAAAAGCAATGGTGAAGATGGG
TAGGATCGGTGTTATTACGGGTCAACAAGGAGAGATTCGATCAAACTGCCGAGTGATAAACAAATAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGTCCCATGATCATGGCTCGTATTCTTACAATTATAACTTTGGTTTCATTACAATGTTTTGTAACTTTGGTTCATTCAAAAGCCCAAGTTCAAATCGGGTTCTATTCGGACTCATGT
TCTGCGGCTGAATCTATTGTCAAACAGGAAGTGAGTAAAGCCTACTCGGAAGACAGGGGTCTTGCTGCCGGTCTCGTGAGACTGCATTTTCACGATTGTTTTGTGAGG
GGTTGTGATGCA
TCGGTCTTAATAGATTCGACTCCTTCAAACCAAGCGGAGAAAGATTCACCTGCAAATAATCCAAGTGTACGTGGATTTAACGTCATTGATAGCGCTAAAGCCAGACTCGAAGCCTCATGT
CCGGGAATTGTTTCTTGTGCTGATATAATTGCATTTGCAGCTAGAGATAGCTTTGAAATA
ACTGGTGGACTGGGGTATGAAGTCCCTGCAGGGAGAAGAGATGGCAGAGTATCACTGATC
GCAGACACGAGAGCATTGCCTCCGGCAACATCTAATCTTGCCCAACTCACTAAGTCGTTTTCAACCAATGGGTTGACCCAAGAAGAAATGGTTACTCTATCCG
GAGCACATACTATTGGC
CGATCACACTGTACAGCCTTTGCTAGCAGGCTATACAATTTCAGCTCCACCGTAAACCTGGACCCGAGTTTGAACCCGTTATATGCTAGCAAGCTAAAACAAGAATGCCCAAAGGGGAGT
AACAACGTGAATTTGGTTGTACCCATGAACCCTAGCTCACCAACCATAAGTGACACAGGTTACTATGTAGACGTCTTGAATAACAGAGGACTATTCACATCAGACCAGTCTCTACTCACG
AGCCAATCGACATTAAACCAAGTGCACCAGCATGCTATGAACCCGCTGGTTTGGAAGATTAAATTTGCAAAAGCAATGGTGAAGATGGGTAGGATCGGTGTTATTACGGGTCAACAAGGA
GAGATTCGATCAAACTGCCGAGTGATAAACAAATAA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TTACTATAAC ACACACATTG CATTATAAAT AAGGTTAAAT TTTCATCACC AATAGTCTGC CATACTGCAC ATGAGTCCCA TGATCATGGC TCGTATTCTT ACAATTATAA CTTTGGTTTC  ATTACAATGT TTTGTAACTT TGGTTCATTC AAAAGCCCAA GTTCAAATCG GGTTCTATTC GGACTCATGT TCTGCGGCTG AATCTATTGT CAAACAGGAA GTGAGTAAAG CCTACTCGGA  AGACAGGGGT CTTGCTGCCG GTCTCGTGAG ACTGCATTTT CACGATTGTT TTGTGAGGGG TTGTGATGCA TCGGTCTTAA TAGATTCGAC TCCTTCAAAC CAAGCGGAGA AAGATTCACC  TGCAAATAAT CCAAGTGTAC GTGGATTTAA CGTCATTGAT AGCGCTAAAG CCAGACTCGA AGCCTCATGT CCGGGAATTG TTTCTTGTGC TGATATAATT GCATTTGCAG CTAGAGATAG  CTTTGAAATA ACTGGTGGAC TGGGGTATGA AGTCCCTGCA GGGAGAAGAG ATGGCAGAGT ATCACTGATC GCAGACACGA GAGCATTGCC TCCGGCAACA TCTAATCTTG CCCAACTCAC  TAAGTCGTTT TCAACCAATG GGTTGACCCA AGAAGAAATG GTTACTCTAT CCGGAGCACA TACTATTGGC CGATCACACT GTACAGCCTT TGCTAGCAGG CTATACAATT TCAGCTCCAC  CGTAAACCTG GACCCGAGTT TGAACCCGTT ATATGCTAGC AAGCTAAAAC AAGAATGCCC AAAGGGGAGT AACAACGTGA ATTTGGTTGT ACCCATGAAC CCTAGCTCAC CAACCATAAG  TGACACAGGT TACTATGTAG ACGTCTTGAA TAACAGAGGA CTATTCACAT CAGACCAGTC TCTACTCACG AGCCAATCGA CATTAAACCA AGTGCACCAG CATGCTATGA ACCCGCTGGT  TTGGAAGATT AAATTTGCAA AAGCAATGGT GAAGATGGGT AGGATCGGTG TTATTACGGG TCAACAAGGA GAGATTCGAT CAAACTGCCG AGTGATAAAC AAATAAAATC AAGCAAGTAA  ACGTGAGGTG CTCAATTATT TTGATCCCTA TGTGTACGTC TTTTCCTTCA AGTGTATAAG CAGTTTGCAG TATAATCACT AAGATATCTT GAATAATATA CGTGTTATGG GTGAGCACAA  AACCGAAAAA AAAAAAACGA ACCGAACAAC CCAAAAAATC ATTTTCTATG GCGTTTGTTA TATATTATTT AATAAGAACA TTAACATGTT TATTTATCTT TAAAATACTT TATCAATTGC 
CTACTTGAGA TAACAAAATT TTA 

Retrieve as FASTA