Entry information : HaPrx59 (HanXRQChr10g0286351.2)
Entry ID 13613
Creation 2016-05-02 (Christophe Dunand)
Last sequence changes 2016-05-02 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2017-11-23 (Catherine Mathe (Scipio))
Peroxidase information: HaPrx59 (HanXRQChr10g0286351.2)
Name (synonym) HaPrx59 (HanXRQChr10g0286351.2)
Class Class III peroxidase    [Orthogroup: Prx040]
Taxonomy Eukaryota Viridiplantae Streptophyta Asteraceae Helianthus
Organism Helianthus annuus (Sunflower)    [TaxId: 4232 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HaPrx59
start..stop
S start..stop
HaPrx132 605 0 1..324 1..324
HaPrx73 594 0 4..324 1..321
HaPrx[P]70 588 0 1..324 1..324
HaPrx71 578 0 1..321 1..321
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 46260494..46260715 222 N° 2 46259836..46260030 195 N° 3 46259106..46259663 558  
complement(join(46259106..46259663,46259836..46260030,46260494..46260715))


exon

Literature and cross-references HaPrx59 (HanXRQChr10g0286351.2)
DNA ref. HanXRQ genome:   HanXRQChr10 (46260715..46259106)
Protein sequence: HaPrx59 (HanXRQChr10g0286351.2)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   324 (301)
PWM (Da):   %s   34909.47 (32401.1) Transmb domain:   %s   i7-29o
PI (pH):   %s   5.4 (5.20) Peptide Signal:   %s   cut: 24 range:24-324
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MVKMNVICFLSLFLSLILSIATASSNSGLSSSYYDRVCPEALPTIKRVVEDALAQERRMGASLLRLHFHDCFVNGCDASILLDQTSTIDSEKNAGPNANSARGFEVIDKIKDEVDKVCGHHVVSCADILTVAARDSVVGLGGPSWKVKLGRRDSTTASQTAANANIPAPSMDLPALIKNFEDQGLDEEDLVVLSGAHTLGFAQCRTFRPRIYSDSNIDPAFASHLRAICPQVGGDLTLAPLDPTPSSFDVKYFSNLVSKKGLLNSDQALLSGGETAELVSKYSGSHEEFWEDFAESMIKMGDIKPLTGNRGEIRNNCRKVNSEY*

Retrieve as FASTA  
Remarks
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGTGAAGATGAATGTCATATGCTTCTTATCTCTTTTTCTTTCTCTCATTCTTTCTATTGCTACAGCATCCTCAAACTCAGGTTTGTCATCAAGTTACTATGACCGAGTGTGCCCTGAA
GCTCTCCCGACCATCAAACGTGTGGTGGAGGATGCATTGGCACAAGAACGCCGCATGGGCGCTTCTCTATTGCGTCTTCATTTTCATGATTGTTTTGTTAAC
GTAAGTAACTTCTTTCTA
CCAACTTAATTATAATTGAAATTTTGCAATCGTTATCCATCATAATAGAACTAAAACATTCATATGGTTATTAGACCAATCATATAAACAAGTCACCTATGAATTAATTAAGTGTTCAAG
TTGATAACAACAATAGCAGTTTTGCACATTGCAATATGATAGGCTCATGTAATATAAACATTTATCTTAATGTTCCTTCTACTTTAAAAAGTTAACTTGTTTTTATTTGTTATTTGATTA
AACATGTAAATTTCATCAAACTTATGTACCTTTGCTAAACTGAGCAATCAAAAACTTCCATTATACTTTCTACTTTCTGTTGATTTGACAACAATTATGAATAAGGTGTTGCAAGATGAA
GTGTTATCTTGTATAGCAATGTTTGCATTTAAGAGATTGGAAAGTGTTGGTGTTATTTTTTGAGATTATTTTCTATATGATGCAGGGATGTGATGCTTCCATACTTTTGGATCAAACGTC
AACAATAGATAGTGAGAAAAATGCAGGTCCTAATGCAAATTCAGCCCGGGGATTCGAGGTTATTGACAAAATCAAAGATGAGGTCGACAAAGTTTGTGGTCACCATGTGGTTTCTTGTGC
TGATATATTAACTGTTGCTGCACGTGATTCGGTCGTTGGG
GTAAGTAAAACACACTTAATAAGTTTCTAATAGTTCAACCGAGTATACCTATGTGGTACACTTTGGTATGAATGTTTTCA
TCAAAAACATTATTTTGTAATATATGTTGAAAAAAAGGTTTGTATGATTATGCATTTTTTGACGTTAATTCTAAAAATTCAATGTTATGCAGCTTGGTGGCCCATCATGGAAAGTCAAGC
TTGGAAGAAGAGACTCAACCACCGCTAGCCAAACCGCAGCTAATGCCAACATCCCAGCACCATCCATGGACTTACCGGCCCTAATAAAAAACTTCGAGGATCAAGGGCTAGATGAGGAGG
ACTTGGTTGTACTTTCAGGTGCCCACACCTTAGGGTTTGCTCAGTGTCGAACCTTTAGGCCTCGTATTTACAGTGATAGCAACATAGATCCAGCCTTTGCGAGCCACCTTCGAGCCATTT
GCCCACAAGTTGGCGGTGACTTAACGCTTGCACCACTTGACCCGACACCAAGCTCGTTTGACGTAAAATATTTTTCTAATTTGGTGAGTAAAAAAGGGCTTTTGAACTCTGATCAAGCAC
TATTAAGTGGTGGTGAAACTGCTGAGCTTGTTTCGAAGTACAGTGGTTCCCACGAAGAGTTTTGGGAGGATTTCGCAGAATCTATGATCAAAATGGGTGATATAAAGCCATTAACAGGGA
ATAGAGGTGAAATTCGCAATAACTGCAGAAAAGTTAATTCGGAATATTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGTGAAGATGAATGTCATATGCTTCTTATCTCTTTTTCTTTCTCTCATTCTTTCTATTGCTACAGCATCCTCAAACTCAGGTTTGTCATCAAGTTACTATGACCGAGTGTGCCCTGAA
GCTCTCCCGACCATCAAACGTGTGGTGGAGGATGCATTGGCACAAGAACGCCGCATGGGCGCTTCTCTATTGCGTCTTCATTTTCATGATTGTTTTGTTAAC
GGATGTGATGCTTCCATA
CTTTTGGATCAAACGTCAACAATAGATAGTGAGAAAAATGCAGGTCCTAATGCAAATTCAGCCCGGGGATTCGAGGTTATTGACAAAATCAAAGATGAGGTCGACAAAGTTTGTGGTCAC
CATGTGGTTTCTTGTGCTGATATATTAACTGTTGCTGCACGTGATTCGGTCGTTGGG
CTTGGTGGCCCATCATGGAAAGTCAAGCTTGGAAGAAGAGACTCAACCACCGCTAGCCAAACC
GCAGCTAATGCCAACATCCCAGCACCATCCATGGACTTACCGGCCCTAATAAAAAACTTCGAGGATCAAGGGCTAGATGAGGAGGACTTGGTTGTACTTTCAGGTGCCCACACCTTAGGG
TTTGCTCAGTGTCGAACCTTTAGGCCTCGTATTTACAGTGATAGCAACATAGATCCAGCCTTTGCGAGCCACCTTCGAGCCATTTGCCCACAAGTTGGCGGTGACTTAACGCTTGCACCA
CTTGACCCGACACCAAGCTCGTTTGACGTAAAATATTTTTCTAATTTGGTGAGTAAAAAAGGGCTTTTGAACTCTGATCAAGCACTATTAAGTGGTGGTGAAACTGCTGAGCTTGTTTCG
AAGTACAGTGGTTCCCACGAAGAGTTTTGGGAGGATTTCGCAGAATCTATGATCAAAATGGGTGATATAAAGCCATTAACAGGGAATAGAGGTGAAATTCGCAATAACTGCAGAAAAGTT
AATTCGGAATATTAA

Retrieve as FASTA