Entry information : HaPrx60 (HanXRQChr08g0214771)
Entry ID 13614
Creation 2016-05-02 (Christophe Dunand)
Last sequence changes 2016-05-02 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2017-11-23 (Catherine Mathe (Scipio))
Peroxidase information: HaPrx60 (HanXRQChr08g0214771)
Name (synonym) HaPrx60 (HanXRQChr08g0214771)
Class Class III peroxidase    [Orthogroup: Prx023]
Taxonomy Eukaryota Viridiplantae Streptophyta Asteraceae Helianthus
Organism Helianthus annuus (Sunflower)    [TaxId: 4232 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HaPrx60
start..stop
S start..stop
HaPrx97 614 0 29..363 1..333
PtPrx95 501 4.63e-180 30..363 7..340
CroPrx18 498 5.33e-179 55..363 16..324
MePrx128 495 1.37e-177 55..363 34..342
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '13614' 'complement(join(22704997..22705421,22705969..22706134,22706264..22706455,22706540..22706848))' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 22706540..22706848 307 N° 2 22706264..22706455 190 N° 3 22705969..22706134 164 N° 4 22704997..22705421 423
complement(join(22704997..22705421,22705969..22706134,22706264..22706455,2270654 0..22706848))


exon

Literature and cross-references HaPrx60 (HanXRQChr08g0214771)
DNA ref. HanXRQ genome:   HanXRQChr08 (22706848..22704997)
Protein sequence: HaPrx60 (HanXRQChr08g0214771)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   363 (303)
PWM (Da):   %s   40056.04 (32541.0)  
PI (pH):   %s   5.72 (6.88) Peptide Signal:   %s   cut: 28 range:28-330
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MQISLLIQPQSQPFPLSTTQETQTNIITMKIKPTIFILSFLTIFC
FKFLHATKTNPPLSLDYYKSSCPNAEAIVRKEMECAVQSDLRNAALILRLHFHDCFVQ
GCDGSVLLDDTVTLQGEKNAPTNLNALKGFEFIDRIKEKLESECPGIVSCADLLTYAARDATVLVGGPYWDVPAGRKDSKTASFSLVESNIPRPNDGLLSIISKFLYQSLSVTDMVALSG
AHTIGMARCTNYRARIYGDYQTTATMSNIAEPNLKNLKATCPAAGGGDNNEAAMDYVSPSLFDNTYYHILLRGEGLLNSDQELYSSVLGVQTSKLVRKYAEDQIAFFAQFSESMVKMGNI
TNPETYVDGEVRKNCRFMNT

Retrieve as FASTA  
Remarks
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCAAATTTCTTTACTTATACAGCCTCAGTCCCAACCATTTCCATTAAGTACCACCCAAGAAACCCAAACCAACATAATCACAATGAAAATCAAACCAACCATCTTCATTCTTTCATTT
CTCACCATCTTTTGCTTCAAGTTCTTGCATGCAACTAAAACTAACCCACCATTGTCTTTAGATTACTACAAATCTTCTTGCCCAAATGCAGAAGCCATTGTTAGGAAAGAAATGGAGTGT
GCTGTGCAGTCTGATCTTAGAAACGCCGCTTTGATCCTACGCTTACACTTCCATGACTGCTTCGTACAA
GTGCGTTCAACAAAAACGATTCTTTCTTTGTTTCCATTTTTGAGCTTTTTA
GTTTGTTATTTAATCTTTCTTGATTTGATCTAGGGGGTTGTGATGGATCGGTGTTGCTAGACGATACAGTCACGTTACAAGGAGAAAAGAATGCTCCCACCAATTTAAATGCTTTGAAGG
GTTTTGAATTCATTGATAGGATAAAGGAAAAGCTTGAATCTGAGTGTCCCGGCATAGTTTCATGCGCTGATCTTCTTACATATGCTGCAAGAGATGCAACTGTGTTG
GTAAGTTAAAACA
TATCGCATTTACCTGGTCCCACTGGTTAACAGGGTATTTGTGGGGTCCAGTAACCGGTCTAGCAATAAAGATTGTTCTCTTATGATTATTGCTGATGTTATGAACTGTGGTTACAGGTGT
TGGTGGACCTTATTGGGATGTCCCGGCTGGTAGAAAAGACTCGAAAACAGCTAGTTTTTCGCTGGTGGAATCAAATATTCCTCGTCCAAACGACGGCCTTCTATCCATCATATCTAAGTT
TCTGTATCAAAGCCTCTCTGTCACTGACATGGTTGCACTTTCTG
GTAAAAAAAAAAAAAAAGTATTCTATAAATTTCAAAAAGGTTGAATTTATTAAAAAAAAAAAAAAAAAAAACCAAC
ATACTTCCTTATTTCTCATAGAAAAATCCCTGAACTAGCTTTGTTATATTAAAGTCTCTCAACTTACAAAAAAGTCAAAACTAATTTTTGTATATTAAAGTCCCTAAACTTATCTAAAAT
ACTTGAACTTTCAAATTTTGTTACAAATATGTCTTGTTAACTTTTAAATTGTGCAACAAAGATTGTATAGTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTGC
AAAACTTATCAAAATTGACCAAATTTAGGAGTATACAAGTGATTATTTCAAAATATTTCACAAGTATGTGCATTTTAGACAAGTGAAGGACTTTACTATACAAAAAAAAAAAAAAAAATT
ATCAAAAGTAAGTAGTTTTTTTTTTTTTTTTATAAAAACCAAGTATAATTGTTTTTTATGATATAAGCGGTGTTTGCCTCGATAAATTTCTCAAGGATCTTTTATTATTAGGTGTGCTCA
CACAATCGGAATGGCTCGTTGTACAAACTATCGAGCAAGAATCTATGGAGACTACCAAACAACCGCAACAATGAGCAACATCGCAGAGCCAAACCTCAAAAATTTAAAGGCAACATGTCC
GGCTGCAGGAGGAGGAGATAACAACGAAGCGGCAATGGACTATGTTTCACCTAGTCTTTTCGATAACACATATTACCACATACTTCTTAGAGGTGAAGGTCTTCTTAATTCGGATCAAGA
ACTCTATTCCAGCGTTCTTGGAGTCCAAACAAGTAAACTTGTGAGGAAATACGCAGAAGATCAGATAGCGTTTTTCGCACAGTTTTCTGAGTCTATGGTGAAAATGGGAAACATTACAAA
TCCTGAGACTTATGTTGATGGTGAAGTGAGGAAGAATTGTAGGTTTATGAATACATAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCAAATTTCTTTACTTATACAGCCTCAGTCCCAACCATTTCCATTAAGTACCACCCAAGAAACCCAAACCAACATAATCACAATGAAAATCAAACCAACCATCTTCATTCTTTCATTT
CTCACCATCTTTTGCTTCAAGTTCTTGCATGCAACTAAAACTAACCCACCATTGTCTTTAGATTACTACAAATCTTCTTGCCCAAATGCAGAAGCCATTGTTAGGAAAGAAATGGAGTGT
GCTGTGCAGTCTGATCTTAGAAACGCCGCTTTGATCCTACGCTTACACTTCCATGACTGCTTCGTACAA
GGTTGTGATGGATCGGTGTTGCTAGACGATACAGTCACGTTACAAGGAGAA
AAGAATGCTCCCACCAATTTAAATGCTTTGAAGGGTTTTGAATTCATTGATAGGATAAAGGAAAAGCTTGAATCTGAGTGTCCCGGCATAGTTTCATGCGCTGATCTTCTTACATATGCT
GCAAGAGATGCAACTGTGTTG
GTTGGTGGACCTTATTGGGATGTCCCGGCTGGTAGAAAAGACTCGAAAACAGCTAGTTTTTCGCTGGTGGAATCAAATATTCCTCGTCCAAACGACGGC
CTTCTATCCATCATATCTAAGTTTCTGTATCAAAGCCTCTCTGTCACTGACATGGTTGCACTTTCTG
GTGCTCACACAATCGGAATGGCTCGTTGTACAAACTATCGAGCAAGAATCTAT
GGAGACTACCAAACAACCGCAACAATGAGCAACATCGCAGAGCCAAACCTCAAAAATTTAAAGGCAACATGTCCGGCTGCAGGAGGAGGAGATAACAACGAAGCGGCAATGGACTATGTT
TCACCTAGTCTTTTCGATAACACATATTACCACATACTTCTTAGAGGTGAAGGTCTTCTTAATTCGGATCAAGAACTCTATTCCAGCGTTCTTGGAGTCCAAACAAGTAAACTTGTGAGG
AAATACGCAGAAGATCAGATAGCGTTTTTCGCACAGTTTTCTGAGTCTATGGTGAAAATGGGAAACATTACAAATCCTGAGACTTATGTTGATGGTGAAGTGAGGAAGAATTGTAGGTTT
ATGAATACATAA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GCAACATATT ACACACGCAT GCATGCAAAT TTCTTTACTT ATACAGCCTC AGTCCCAACC ATTTCCATTA AGTACCACCC AAGAAACCCA AACCAACATA ATCACAATGA AAATCAAACC  AACCATCTTC ATTCTTTCAT TTCTCACCAT CTTTTGCTTC AAGTTCTTGC ATGCAACTAA AACTAACCCA CCATTGTCTT TAGATTACTA CAAATCTTCT TGCCCAAATG CAGAAGCCAT  TGTTAGGAAA GAAATGGAGT GTGCTGTGCA GTCTGATCTT AGAAACGCCG CTTTGATCCT ACGCTTACAC TTCCATGACT GCTTCGTACA AGGTTGTGAT GGATCGGTGT TGCTAGACGA  TACAGTCACG TTACAAGGAG AAAAGAATGC TCCCACCAAT TTAAATGCTT TGAAGGGTTT TGAATTCATT GATAGGATAA AGGAAAAGCT TGAATCTGAG TGTCCCGGCA TAGTTTCATG  CGCTGATCTT CTTACATATG CTGCAAGAGA TGCAACTGTG TTGGTTGGTG GACCTTATTG GGATGTCCCG GCTGGTAGAA AAGACTCGAA AACAGCTAGT TTTTCGCTGG TGGAATCAAA  TATTCCTCGT CCAAACGACG GCCTTCTATC CATCATATCT AAGTTTCTGT ATCAAAGCCT CTCTGTCACT GACATGGTTG CACTTTCTGG TGCTCACACA ATCGGAATGG CTCGTTGTAC  AAACTATCGA GCAAGAATCT ATGGAGACTA CCAAACAACC GCAACAATGA GCAACATCGC AGAGCCAAAC CTCAAAAATT TAAAGGCAAC ATGTCCGGCT GCAGGAGGAG GAGATAACAA  CGAAGCGGCA ATGGACTATG TTTCACCTAG TCTTTTCGAT AACACATATT ACCACATACT TCTTAGAGGT GAAGGTCTTC TTAATTCGGA TCAAGAACTC TATTCCAGCG TTCTTGGAGT  CCAAACAAGT AAACTTGTGA GGAAATACGC AGAAGATCAG ATAGCGTTTT TCGCACAGTT TTCTGAGTCT ATGGTGAAAA TGGGAAACAT TACAAATCCT GAGACTTATG TTGATGGTGA  AGTGAGGAAG AATTGTAGGT TTATGAATAC ATAAAGATGG ATTGGTGATT GATTTTACAA GGTTTTAATT TTATTATATT CATGATCAAG ATGTAATCTG GGCCTTATTT ATATTTATAA 
CACTATGTTA TTGAAATTAT TATATATTGT TTTTAAAAAT CGTGTAAAAA ATATTTAAAT ATGGTGTTCA TTGGT 

Retrieve as FASTA