Entry information : HaPrx62 (HanXRQChr09g0239821)
Entry ID 13616
Creation 2016-05-02 (Christophe Dunand)
Last sequence changes 2016-05-02 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2017-11-23 (Catherine Mathe (Scipio))
Peroxidase information: HaPrx62 (HanXRQChr09g0239821)
Name (synonym) HaPrx62 (HanXRQChr09g0239821)
Class Class III peroxidase    [Orthogroup: Prx018]
Taxonomy Eukaryota Viridiplantae Streptophyta Asteraceae Helianthus
Organism Helianthus annuus (Sunflower)    [TaxId: 4232 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HaPrx62
start..stop
S start..stop
HaPrx96 616 0 1..329 1..329
HaPrx134 612 0 1..328 1..328
HaPrx45 605 0 1..329 1..329
HaPrx74 454 2e-162 6..329 4..327
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 15232631..15232852 222 N° 2 15232334..15232516 183 N° 3 15231938..15232100 163 N° 4 15230938..15231359 422
complement(join(15230938..15231359,15231938..15232100,15232334..15232516,1523263 1..15232852))


exon

Literature and cross-references HaPrx62 (HanXRQChr09g0239821)
DNA ref. HanXRQ genome:   HanXRQChr09 (15232852..15230938)
Protein sequence: HaPrx62 (HanXRQChr09g0239821)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   329
PWM (Da):   %s   35596.11 Transmb domain:   %s   i7-24o
PI (pH):   %s   6.39
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MKLIKMTMVVLAIIITFEFFIVANSQGQLKVGFYNQVCPNAESVVTNIVRDAAKSDHRIPPGLLRLHFHDCFVEGCDGSILTDNGNTSEKGAFGHQGLIGFDIIEDAKAKLESLCPGVVSCADIVAMAARDAVAFSHGPVYQVETGRKDGLVSNIDLANRMPDVRDSIQLLKQKFIEKGLNAKDLVILSAAHTIGSTACFFMEERLYNFASRGGPDPSINPRLLPELTSTCPKNGDVGVRLPMDHGSEDTFDIQILQNIRSGFAVLQSDAKLMDDVTTRGIVDSYFGVLAPLTGPSFEADFVTSMIRMGRIGVKTGSNGNIRRLCKSFN

Retrieve as FASTA  
Remarks
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAATTGATCAAAATGACCATGGTGGTGCTGGCTATCATAATAACATTTGAGTTTTTCATTGTAGCTAATTCACAAGGTCAACTCAAAGTAGGGTTTTACAATCAGGTGTGTCCCAAC
GCAGAATCAGTGGTTACTAATATTGTGAGAGATGCAGCGAAGTCCGACCATCGTATTCCTCCTGGCTTGCTCAGGCTTCACTTTCATGACTGCTTTGTTGAG
GTTCTCCATCTCTCACAA
ACACATTTAGAAATTAATTAAGCGACGGGTTTGTGATGGTTTATGTTGTCATATTTGTAGCAGTATTGTATTGCTTACAATTTTGTTTATTTGTAGGGGTGTGATGGGTCCATATTAACA
GATAATGGTAACACTTCAGAGAAAGGTGCATTCGGGCATCAAGGGTTAATAGGGTTTGACATAATAGAGGATGCAAAAGCAAAGTTGGAAAGTTTATGTCCTGGTGTGGTTTCATGTGCG
GATATTGTGGCCATGGCTGCAAGAGATGCTGTTGCATTC
GTAAGTTAAAGAACACGCACAATTATTATCTGTTAAAAATGTCATTTTTACTGTTTTTCTCTCACACGCAGTGTAAGTATA
TATGTGTGAGAGAGAGAGTTAGATTGAGTCATTCAGATTATCTGAACCGAATGACTCAATCTATCTCTCTCTCACATATACTTACACTGTGTGTGAGAGAAAAACGATAAAAATGACATC
TTTTTAACAGATAATAATTGTTTTTCTGACAGAGTCATGGACCAGTTTATCAAGTTGAAACCGGAAGGAAGGATGGTCTAGTGTCAAACATTGATCTTGCTAATAGAATGCCTGATGTGA
GAGATTCAATACAGCTTCTGAAACAAAAGTTCATTGAGAAGGGGCTTAATGCCAAAGACCTTGTGATTCTCAGTG
GTAATTTTGTTTGGTTTATATTTATTTAATCTTTTGGGAAAATTA
CAAAAATAGTTATGTTGACCAAACAATTCTCTAAAACTTATCATTCATTTCCGCAAATCGAAAGCCTGCCAGATAAGCTTTATCGGTTGAGACGGCTAAAATGTAGCCTACACTTTTAGC
GGTCGGCTAAGCCTGCACATTTGGCAAAAGGGTCGGCCAGGTCTGCGCTTTTGGGTGCTTGCTAAAGGTTAGCCACGCCTTTTGAGGACGGCTAAGGTTCACTGACTCTTTTTAAAAAAA
AAAAAATTGGGTCAACTACACTATTTTGATAATTTTCCTTTATCTTTTGGGTTCCATTCATGCACTTTATAGGATATCTTTTAACACAGTTAACAATATATATGTGTGTTATTGATCATA
ATATTTACTACTTCTGTGATTGTACCAACCATATTCTTTCCTGCCTTAAATGCTTTTATTGTGTCTGCAATAAATGAAAGCAAATCATCTAGTTTTCTATTAAAAGTTTGTACCAAAAAC
ATGAATAAAATTATGTGCGAATTTTAATAGCTTACTTTATCGCTAATATTCAGCTGCACATACTATCGGTTCAACTGCGTGCTTCTTCATGGAGGAACGGCTCTACAACTTTGCATCACG
TGGTGGTCCAGACCCGAGTATCAACCCTCGTTTGCTACCTGAACTGACATCGACATGCCCTAAAAATGGAGACGTTGGCGTCAGATTACCAATGGATCATGGGAGCGAAGACACATTTGA
CATTCAAATCCTACAAAACATTAGGAGTGGTTTTGCGGTGCTACAGTCGGATGCAAAGCTTATGGACGACGTGACAACAAGGGGAATAGTAGATTCGTATTTCGGGGTGTTGGCTCCGTT
AACTGGACCATCATTTGAGGCGGATTTTGTGACTTCCATGATAAGAATGGGTAGAATTGGGGTCAAGACCGGTTCTAATGGAAATATTAGGCGTCTATGTAAATCGTTTAATTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAATTGATCAAAATGACCATGGTGGTGCTGGCTATCATAATAACATTTGAGTTTTTCATTGTAGCTAATTCACAAGGTCAACTCAAAGTAGGGTTTTACAATCAGGTGTGTCCCAAC
GCAGAATCAGTGGTTACTAATATTGTGAGAGATGCAGCGAAGTCCGACCATCGTATTCCTCCTGGCTTGCTCAGGCTTCACTTTCATGACTGCTTTGTTGAG
GGGTGTGATGGGTCCATA
TTAACAGATAATGGTAACACTTCAGAGAAAGGTGCATTCGGGCATCAAGGGTTAATAGGGTTTGACATAATAGAGGATGCAAAAGCAAAGTTGGAAAGTTTATGTCCTGGTGTGGTTTCA
TGTGCGGATATTGTGGCCATGGCTGCAAGAGATGCTGTTGCATTC
AGTCATGGACCAGTTTATCAAGTTGAAACCGGAAGGAAGGATGGTCTAGTGTCAAACATTGATCTTGCTAATAGA
ATGCCTGATGTGAGAGATTCAATACAGCTTCTGAAACAAAAGTTCATTGAGAAGGGGCTTAATGCCAAAGACCTTGTGATTCTCAGTG
CTGCACATACTATCGGTTCAACTGCGTGCTTC
TTCATGGAGGAACGGCTCTACAACTTTGCATCACGTGGTGGTCCAGACCCGAGTATCAACCCTCGTTTGCTACCTGAACTGACATCGACATGCCCTAAAAATGGAGACGTTGGCGTCAGA
TTACCAATGGATCATGGGAGCGAAGACACATTTGACATTCAAATCCTACAAAACATTAGGAGTGGTTTTGCGGTGCTACAGTCGGATGCAAAGCTTATGGACGACGTGACAACAAGGGGA
ATAGTAGATTCGTATTTCGGGGTGTTGGCTCCGTTAACTGGACCATCATTTGAGGCGGATTTTGTGACTTCCATGATAAGAATGGGTAGAATTGGGGTCAAGACCGGTTCTAATGGAAAT
ATTAGGCGTCTATGTAAATCGTTTAATTAA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TCATACCACT CCCCCCTTCC TTTCTTCATC CATTTCATAT TCTTCTTAAC AAATACATCA TGAAATTGAT CAAAATGACC ATGGTGGTGC TGGCTATCAT AATAACATTT GAGTTTTTCA  TTGTAGCTAA TTCACAAGGT CAACTCAAAG TAGGGTTTTA CAATCAGGTG TGTCCCAACG CAGAATCAGT GGTTACTAAT ATTGTGAGAG ATGCAGCGAA GTCCGACCAT CGTATTCCTC  CTGGCTTGCT CAGGCTTCAC TTTCATGACT GCTTTGTTGA GGGGTGTGAT GGGTCCATAT TAACAGATAA TGGTAACACT TCAGAGAAAG GTGCATTCGG GCATCAAGGG TTAATAGGGT  TTGACATAAT AGAGGATGCA AAAGCAAAGT TGGAAAGTTT ATGTCCTGGT GTGGTTTCAT GTGCGGATAT TGTGGCCATG GCTGCAAGAG ATGCTGTTGC ATTCAGTCAT GGACCAGTTT  ATCAAGTTGA AACCGGAAGG AAGGATGGTC TAGTGTCAAA CATTGATCTT GCTAATAGAA TGCCTGATGT GAGAGATTCA ATACAGCTTC TGAAACAAAA GTTCATTGAG AAGGGGCTTA  ATGCCAAAGA CCTTGTGATT CTCAGTGCTG CACATACTAT CGGTTCAACT GCGTGCTTCT TCATGGAGGA ACGGCTCTAC AACTTTGCAT CACGTGGTGG TCCAGACCCG AGTATCAACC  CTCGTTTGCT ACCTGAACTG ACATCGACAT GCCCTAAAAA TGGAGACGTT GGCGTCAGAT TACCAATGGA TCATGGGAGC GAAGACACAT TTGACATTCA AATCCTACAA AACATTAGGA  GTGGTTTTGC GGTGCTACAG TCGGATGCAA AGCTTATGGA CGACGTGACA ACAAGGGGAA TAGTAGATTC GTATTTCGGG GTGTTGGCTC CGTTAACTGG ACCATCATTT GAGGCGGATT  TTGTGACTTC CATGATAAGA ATGGGTAGAA TTGGGGTCAA GACCGGTTCT AATGGAAATA TTAGGCGTCT ATGTAAATCG TTTAATTAAC ATGATAGAAT AAAAGGAGCT AGTGTCTCTT 
GCAAATTACG ATCATAGACT TATTTTTGTT ATATATACAG GAGCTAGTGT CACTTGCAAA TTACAACCAT AGACTTATTT TAGTTATATA TACACTTTTG AGTTTTGACC A 

Retrieve as FASTA