Entry information : HaPrx63 (HanXRQChr09g0245221)
Entry ID 13617
Creation 2016-05-02 (Christophe Dunand)
Last sequence changes 2016-05-02 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2017-11-23 (Catherine Mathe (Scipio))
Peroxidase information: HaPrx63 (HanXRQChr09g0245221)
Name (synonym) HaPrx63 (HanXRQChr09g0245221)
Class Class III peroxidase    [Orthogroup: Prx016]
Taxonomy Eukaryota Viridiplantae Streptophyta Asteraceae Helianthus
Organism Helianthus annuus (Sunflower)    [TaxId: 4232 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HaPrx63
start..stop
S start..stop
HaPrx04 562 0 1..313 1..312
LsPrx43 538 0 1..299 4..301
HaPrx66 525 0 1..313 1..314
PpePrx30 505 0 3..313 6..318
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 51882341..51882535 195 N° 2 51882044..51882232 189 N° 3 51881527..51881689 163 N° 4 51880724..51881118 395
complement(join(51880724..51881118,51881527..51881689,51882044..51882232,5188234 1..51882535))


exon

Literature and cross-references HaPrx63 (HanXRQChr09g0245221)
DNA ref. HanXRQ genome:   HanXRQChr09 (51882535..51880724)
Protein sequence: HaPrx63 (HanXRQChr09g0245221)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   313 (294)
PWM (Da):   %s   33318.08 (31384.0)  
PI (pH):   %s   9.95 (9.95) Peptide Signal:   %s   cut: 20 range:20-313
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSALLSSLLILSLFSTGISLSSNYYEKTCPNAESLIRKAVRDAATNDKKVPAALLRMHFHDCFIRGCDASVLLDSKGKNTAEKDGPPNVSLHAFYVIDNAKSAVESACPGIVSCADILALAARDAVVLSGGPSWVVPKGRKDGRTSLASETRQLPAPTFNISQLQQSFAQRGLSLKDLVALSGGHTLGFSHCSSFKNRIHNFNSTTDVDPSINPSFAASLKSTCPATNNAKNAGVPMDPSSTSFDNTYYKLLFQQKTLFSSDKALLDSPKTKNIAAKFASSKGAFTKAFIKSMIKMSSITGGQEVRKNCKVVN

Retrieve as FASTA  
Remarks
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCTGCATTGTTAAGCTCACTACTCATTCTCTCATTATTCTCAACAGGAATTTCACTAAGTTCAAACTACTATGAAAAAACATGCCCTAATGCAGAATCACTCATCCGAAAAGCAGTG
AGGGACGCCGCGACAAATGACAAAAAAGTCCCTGCGGCATTGCTTAGGATGCACTTTCATGACTGTTTCATAAGG
GTACAAAAGGGAACTGTTTACATCTTCTTTACTATGTTTAAGTTG
CATACTTGTATCATTTTTTGTTTAATATATTGCTAACCCTTCAAGGTTTGATCTAACTTGTAGGGGTGTGACGCTTCGGTTTTGCTGGATTCGAAGGGAAAAAACACTGCTGAAAAAGAT
GGACCACCAAATGTTTCTTTGCATGCGTTTTACGTCATCGACAATGCTAAAAGTGCAGTTGAATCTGCATGCCCGGGAATAGTTTCTTGTGCTGATATCTTAGCTTTAGCAGCAAGAGAT
GCGGTTGTGCTG
GTAATAACGAACATTATATTGTTTCAATATTTTTGGTTGATATCTTTGCATACCATCGTTTTACCTGCTAAAGAAAGGACATATAACCCACCTCGTTAATAAGTAAAT
GGGCTGAAAACGGATAATAAAAGTTACTATACTTGATCTATAACGAAAAGGCTAAGAAAGGTATGAAATACTGAGTTTCCTGAAGTCTTGATGGACATATCACATCATGTTATACCATTC
GACTCTATGTGCATATTGTAGAACTTTTACTGAATGTAACTAATGTTATAATTTATGGTAAATGACAATTACACATTATATTGTATGTAACTAATGTTATTAACAAATGCGTACACGTCT
ATACAGTCTGGAGGGCCATCCTGGGTTGTACCTAAGGGAAGAAAAGATGGAAGAACATCACTAGCCAGTGAAACCAGACAACTCCCTGCTCCTACTTTCAACATTTCTCAACTTCAACAA
AGCTTTGCTCAAAGAGGTTTATCTTTAAAAGATCTTGTAGCACTTTCAG
GTAACTTCAGTTCTCATATTAAGTTAATAAAATAGTGCATTAACATATACATCTTCTTTTGTTCTTTTTTC
ATGCAAAAGTAAATGCATCATTTCTCTTGTGACAAAGATTAAAGCCAAAGTTATATCCATTTTAAGTTTTGCCCTTTTTAGCTCACTTCCTTTTGTCTGGTTGGTCCGAATACGAGTCTC
TAGGTTCTTGGATTACCTCCTTATCAAATTTGGTGTCGGGATGACCCAAATTACTTTTTAGTTTTTCCAAATATTCTAAGTTTATTAAAACTAGTCATCTTGTTAAATATATTAAAATAT
TATATCATTTTCGTTTGACCCAGTTTCCTACACTTCCTAGGTCAATCAGTCTTCGTTCGACCCAGTTTCCTATACTAACGGATTTTTGTGTATGTAGGTGGGCATACTCTTGGTTTCTCC
CATTGCTCATCATTCAAAAACAGAATCCACAACTTCAACTCCACAACTGATGTTGACCCTTCAATCAACCCTTCATTTGCTGCAAGTTTAAAAAGCACTTGCCCAGCCACCAACAATGCA
AAGAATGCAGGAGTTCCAATGGATCCTTCTTCTACAAGTTTTGATAATACATACTACAAACTCCTCTTCCAACAAAAAACATTATTTTCTTCGGACAAAGCTTTGCTTGATTCCCCAAAA
ACAAAAAATATTGCCGCAAAGTTTGCAAGCTCAAAAGGTGCATTCACAAAGGCATTTATAAAGTCCATGATCAAGATGAGTAGCATTACAGGTGGTCAGGAGGTTAGGAAGAACTGTAAG
GTGGTAAACTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCTGCATTGTTAAGCTCACTACTCATTCTCTCATTATTCTCAACAGGAATTTCACTAAGTTCAAACTACTATGAAAAAACATGCCCTAATGCAGAATCACTCATCCGAAAAGCAGTG
AGGGACGCCGCGACAAATGACAAAAAAGTCCCTGCGGCATTGCTTAGGATGCACTTTCATGACTGTTTCATAAGG
GGGTGTGACGCTTCGGTTTTGCTGGATTCGAAGGGAAAAAACACT
GCTGAAAAAGATGGACCACCAAATGTTTCTTTGCATGCGTTTTACGTCATCGACAATGCTAAAAGTGCAGTTGAATCTGCATGCCCGGGAATAGTTTCTTGTGCTGATATCTTAGCTTTA
GCAGCAAGAGATGCGGTTGTGCTG
TCTGGAGGGCCATCCTGGGTTGTACCTAAGGGAAGAAAAGATGGAAGAACATCACTAGCCAGTGAAACCAGACAACTCCCTGCTCCTACTTTCAAC
ATTTCTCAACTTCAACAAAGCTTTGCTCAAAGAGGTTTATCTTTAAAAGATCTTGTAGCACTTTCAG
GTGGGCATACTCTTGGTTTCTCCCATTGCTCATCATTCAAAAACAGAATCCAC
AACTTCAACTCCACAACTGATGTTGACCCTTCAATCAACCCTTCATTTGCTGCAAGTTTAAAAAGCACTTGCCCAGCCACCAACAATGCAAAGAATGCAGGAGTTCCAATGGATCCTTCT
TCTACAAGTTTTGATAATACATACTACAAACTCCTCTTCCAACAAAAAACATTATTTTCTTCGGACAAAGCTTTGCTTGATTCCCCAAAAACAAAAAATATTGCCGCAAAGTTTGCAAGC
TCAAAAGGTGCATTCACAAAGGCATTTATAAAGTCCATGATCAAGATGAGTAGCATTACAGGTGGTCAGGAGGTTAGGAAGAACTGTAAGGTGGTAAACTAG

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GAGTTCAAAT ACAAAGAACA TATAACCATA TTGGTCATCA TGTCTGCATT GTTAAGCTCA CTACTCATTC TCTCATTATT CTCAACAGGA ATTTCACTAA GTTCAAACTA CTATGAAAAA  ACATGCCCTA ATGCAGAATC ACTCATCCGA AAAGCAGTGA GGGACGCCGC GACAAATGAC AAAAAAGTCC CTGCGGCATT GCTTAGGATG CACTTTCATG ACTGTTTCAT AAGGGGGTGT  GACGCTTCGG TTTTGCTGGA TTCGAAGGGA AAAAACACTG CTGAAAAAGA TGGACCACCA AATGTTTCTT TGCATGCGTT TTACGTCATC GACAATGCTA AAAGTGCAGT TGAATCTGCA  TGCCCGGGAA TAGTTTCTTG TGCTGATATC TTAGCTTTAG CAGCAAGAGA TGCGGTTGTG CTGTCTGGAG GGCCATCCTG GGTTGTACCT AAGGGAAGAA AAGATGGAAG AACATCACTA  GCCAGTGAAA CCAGACAACT CCCTGCTCCT ACTTTCAACA TTTCTCAACT TCAACAAAGC TTTGCTCAAA GAGGTTTATC TTTAAAAGAT CTTGTAGCAC TTTCAGGTGG GCATACTCTT  GGTTTCTCCC ATTGCTCATC ATTCAAAAAC AGAATCCACA ACTTCAACTC CACAACTGAT GTTGACCCTT CAATCAACCC TTCATTTGCT GCAAGTTTAA AAAGCACTTG CCCAGCCACC  AACAATGCAA AGAATGCAGG AGTTCCAATG GATCCTTCTT CTACAAGTTT TGATAATACA TACTACAAAC TCCTCTTCCA ACAAAAAACA TTATTTTCTT CGGACAAAGC TTTGCTTGAT  TCCCCAAAAA CAAAAAATAT TGCCGCAAAG TTTGCAAGCT CAAAAGGTGC ATTCACAAAG GCATTTATAA AGTCCATGAT CAAGATGAGT AGCATTACAG GTGGTCAGGA GGTTAGGAAG  AACTGTAAGG TGGTAAACTA GACAACCGCG TATATCAAAT TTCAATTAAC GTATATTAAG TACTTGGTGT CCAGTTCAGA AACGGTGATA AGCTAGTTCT TTCTAGCAAG TTAAAACGGA  GTCTTTGCAA GAATGTGACA TGGTCATATA GAATTATACT GCAAATAAAC TTGATAGATT ACAAGGGCAT TTGTGACTGA AAGACACAAT TTGAGTAAAA TCAGGCGAAA ATATATACAC 
CTAAAGAAAC ATTAATTTGG 

Retrieve as FASTA