Entry information : HaPrx66 (HanXRQChr09g0257331)
Entry ID 13620
Creation 2016-05-02 (Christophe Dunand)
Last sequence changes 2016-05-02 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2017-11-23 (Catherine Mathe (Scipio))
Peroxidase information: HaPrx66 (HanXRQChr09g0257331)
Name (synonym) HaPrx66 (HanXRQChr09g0257331)
Class Class III peroxidase    [Orthogroup: Prx016]
Taxonomy Eukaryota Viridiplantae Streptophyta Asteraceae Helianthus
Organism Helianthus annuus (Sunflower)    [TaxId: 4232 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HaPrx66
start..stop
S start..stop
HaPrx04 510 0 1..314 1..312
CroPrx21 504 0 3..314 2..312
HaPrx63 504 0 17..314 17..313
MePrx02 499 2e-180 4..314 8..316
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 138130663..138130857 195 N° 2 138130956..138131144 189 N° 3 138131394..138131556 163 N° 4 138132137..138132534 398
join(138130663..138130857,138130956..138131144,138131394..138131556,138132137..1 38132534)


exon

Literature and cross-references HaPrx66 (HanXRQChr09g0257331)
DNA ref. HanXRQ genome:   HanXRQChr09 (138130663..138132534)
Protein sequence: HaPrx66 (HanXRQChr09g0257331)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   314 (295)
PWM (Da):   %s   33567.15 (31547.1)  
PI (pH):   %s   10.1 (10.10) Peptide Signal:   %s   cut: 20 range:20-314
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAAFLSSLLIFSLFSFGTSLTSNYYQKTCPAVESLVRKAVTDATKRDKTAPAGLLRMHFHDCFIRGCDGSVLLSSKGNNKAEKDGPPNVSLHAFYVVDNAKRAVESVCPGVVSCADILALAARDAVVVSGGPSWVVPKGRKDGRISKASETIQLPAPTFNISQLQQSFSQRGLSLEDLAALSGGHTLGSSHCSSFNNRIHNFNSTTDIDPSLHPSFAASLRRVCPAKNNAKKAGVAMDPSSSTFDNTYYKLILQHKVLFSSDNALLNSPKTRSLVSKFASTNDAFSKAFVKSMIKMSSITGGGQEIRKNCRVVN

Retrieve as FASTA  
Remarks
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTGCATTTTTAAGCTCATTGCTCATTTTCTCATTATTTTCTTTTGGAACTTCATTGACCTCAAATTATTACCAAAAAACATGCCCTGCTGTGGAATCATTAGTCCGGAAAGCGGTA
ACCGACGCAACAAAACGTGACAAAACCGCCCCGGCGGGGCTCCTTCGGATGCATTTCCACGACTGTTTTATACGG
GTATGACTATTGACCACCGGCCATATATTGTTTTGTTTATCTTTT
AGTTGAAAGTCCTAGTAATGTTAATCTGTGTTGGTTTTGATGATGAATTGAAGGGGTGTGATGGTTCGGTTTTGTTGAGTTCTAAGGGTAATAACAAAGCTGAAAAAGATGGTCCGCCTA
ATGTTTCGCTGCATGCGTTTTATGTTGTTGATAACGCGAAAAGAGCTGTTGAATCTGTGTGTCCTGGTGTGGTCTCATGTGCGGATATCTTGGCCTTAGCTGCAAGAGATGCAGTTGTGG
TG
GTAAGCATAAAAATTATGCAAATGTATTTTATCTGGCGTTTGAGCCGGGGGTCTCATTGGAAGCAGCCTCTCTATTCCTACGGGATAGAGGTAAGGCTGTCTACATCTTACCCTCCTC
AGACCCTACCTTAGCTTTGCTATTGGTGGGATTTACTGAGTATGATGATGATGATGATTTTATCTGGCGTATGCACGTCATATACGCCTATCTTGTGCACAAAGTATAAGTTAAAGAAAA
TTTAAATGCAGTCTGGAGGACCATCTTGGGTTGTGCCTAAAGGAAGAAAAGATGGAAGAATATCCAAAGCAAGTGAAACCATACAACTACCAGCTCCCACCTTCAACATTTCTCAACTTC
AACAAAGTTTCTCTCAGAGAGGTCTCTCCTTAGAAGATCTAGCAGCACTTTCAG
GTAATAAATAAGATCAACACAAAAGAAGAAAAAGAAATCATAAACCTGGTCCCGGACATCTACCAT
TATACCCATAATTGTCGGCCAATTTTATTGTTGTCCATAATGGAAATGAACATTTACCTATTTATATAACAGATCACATGGTAAGCAAGTATGATGGTCCTAATGATGATCCTACATGTA
TTTCGTGTATATGTCTCACAGGTGGATTAAAAAAAAAAAAAAACAGCGCAAATTAACTTGGGTTACACGTGTGGTTCTACTTCTGGATGTATTCCTTACCCTGGGACCAAACTGGTTATT
GGGCGGTGAAAATTGTAACAGATGTATTATTTGTTTTTTTTTTAATTTTTATATGGTTTTTGTGTGCAAGAAATCAAGTTTTAGTATATCGGACTCTGTAACACGTCAAAATTGGTTATG
GTCAAAACGGGTCATTTTTATTATAAGTTGGATTAGGTTGATCCTAAAGTTTTTTTAATCCAATTTTCAATAAATAGTTACAAAACCAAGTTATATGCATTAAAAGTATATTTTGGGTGA
CTTTTGACTTGTTTGACACTTGGTACTAAATCAGGAGGGCATACTCTCGGGTCCTCGCATTGCTCGTCTTTCAACAACAGAATCCACAACTTCAACTCGACAACTGACATCGACCCGTCA
CTCCATCCATCATTTGCTGCAAGCTTAAGACGCGTTTGCCCTGCCAAAAACAATGCAAAGAAAGCAGGAGTCGCAATGGATCCTTCGTCTTCTACTTTTGATAATACATATTACAAATTA
ATCTTGCAGCACAAAGTTTTATTTTCTTCAGATAATGCTTTGCTCAATTCCCCTAAGACCAGAAGTTTGGTATCTAAGTTTGCTAGCACAAATGATGCTTTTTCGAAAGCGTTTGTCAAG
TCGATGATCAAAATGAGTAGCATCACCGGGGGCGGTCAGGAGATCAGGAAGAACTGTAGGGTTGTAAACTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTGCATTTTTAAGCTCATTGCTCATTTTCTCATTATTTTCTTTTGGAACTTCATTGACCTCAAATTATTACCAAAAAACATGCCCTGCTGTGGAATCATTAGTCCGGAAAGCGGTA
ACCGACGCAACAAAACGTGACAAAACCGCCCCGGCGGGGCTCCTTCGGATGCATTTCCACGACTGTTTTATACGG
GGGTGTGATGGTTCGGTTTTGTTGAGTTCTAAGGGTAATAACAAA
GCTGAAAAAGATGGTCCGCCTAATGTTTCGCTGCATGCGTTTTATGTTGTTGATAACGCGAAAAGAGCTGTTGAATCTGTGTGTCCTGGTGTGGTCTCATGTGCGGATATCTTGGCCTTA
GCTGCAAGAGATGCAGTTGTGGTG
TCTGGAGGACCATCTTGGGTTGTGCCTAAAGGAAGAAAAGATGGAAGAATATCCAAAGCAAGTGAAACCATACAACTACCAGCTCCCACCTTCAAC
ATTTCTCAACTTCAACAAAGTTTCTCTCAGAGAGGTCTCTCCTTAGAAGATCTAGCAGCACTTTCAG
GAGGGCATACTCTCGGGTCCTCGCATTGCTCGTCTTTCAACAACAGAATCCAC
AACTTCAACTCGACAACTGACATCGACCCGTCACTCCATCCATCATTTGCTGCAAGCTTAAGACGCGTTTGCCCTGCCAAAAACAATGCAAAGAAAGCAGGAGTCGCAATGGATCCTTCG
TCTTCTACTTTTGATAATACATATTACAAATTAATCTTGCAGCACAAAGTTTTATTTTCTTCAGATAATGCTTTGCTCAATTCCCCTAAGACCAGAAGTTTGGTATCTAAGTTTGCTAGC
ACAAATGATGCTTTTTCGAAAGCGTTTGTCAAGTCGATGATCAAAATGAGTAGCATCACCGGGGGCGGTCAGGAGATCAGGAAGAACTGTAGGGTTGTAAACTAA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GTTGTAAACC AATAACAATT GGCTCATTTT TTGTACAAAT AGACCATTAA ATCATGAATT CCATGCAACT CCATTGAATG TAAACAAAGT AAGCATGGCT GCATTTTTAA GCTCATTGCT  CATTTTCTCA TTATTTTCTT TTGGAACTTC ATTGACCTCA AATTATTACC AAAAAACATG CCCTGCTGTG GAATCATTAG TCCGGAAAGC GGTAACCGAC GCAACAAAAC GTGACAAAAC  CGCCCCGGCG GGGCTCCTTC GGATGCATTT CCACGACTGT TTTATACGGG GGTGTGATGG TTCGGTTTTG TTGAGTTCTA AGGGTAATAA CAAAGCTGAA AAAGATGGTC CGCCTAATGT  TTCGCTGCAT GCGTTTTATG TTGTTGATAA CGCGAAAAGA GCTGTTGAAT CTGTGTGTCC TGGTGTGGTC TCATGTGCGG ATATCTTGGC CTTAGCTGCA AGAGATGCAG TTGTGGTGTC  TGGAGGACCA TCTTGGGTTG TGCCTAAAGG AAGAAAAGAT GGAAGAATAT CCAAAGCAAG TGAAACCATA CAACTACCAG CTCCCACCTT CAACATTTCT CAACTTCAAC AAAGTTTCTC  TCAGAGAGGT CTCTCCTTAG AAGATCTAGC AGCACTTTCA GGAGGGCATA CTCTCGGGTC CTCGCATTGC TCGTCTTTCA ACAACAGAAT CCACAACTTC AACTCGACAA CTGACATCGA  CCCGTCACTC CATCCATCAT TTGCTGCAAG CTTAAGACGC GTTTGCCCTG CCAAAAACAA TGCAAAGAAA GCAGGAGTCG CAATGGATCC TTCGTCTTCT ACTTTTGATA ATACATATTA  CAAATTAATC TTGCAGCACA AAGTTTTATT TTCTTCAGAT AATGCTTTGC TCAATTCCCC TAAGACCAGA AGTTTGGTAT CTAAGTTTGC TAGCACAAAT GATGCTTTTT CGAAAGCGTT  TGTCAAGTCG ATGATCAAAA TGAGTAGCAT CACCGGGGGC GGTCAGGAGA TCAGGAAGAA CTGTAGGGTT GTAAACTAAT TAAGCAATTA GCCAACCTAT GAAGATGTAC ACATTGTATG  TAACTATGCT TGAACATTGA AATTTTATGC GGCTCATGTA ATATATGTAA AATAAATTAA AATATGAATT TGTTATGATA ATGAAGGGCA AGTTGTCAAA TCTTTAGGCT TAAATGGTTT 
TGTTAATATT ATTATGAGTA AAGTGC 

Retrieve as FASTA