Entry information : HaPrx67 (HanXRQChr09g0261221)
Entry ID 13621
Creation 2016-05-02 (Christophe Dunand)
Last sequence changes 2016-05-02 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2017-11-23 (Catherine Mathe (Scipio))
Peroxidase information: HaPrx67 (HanXRQChr09g0261221)
Name (synonym) HaPrx67 (HanXRQChr09g0261221)
Class Class III peroxidase     [Orthogroup: Prx004]*
Taxonomy Eukaryota Viridiplantae Streptophyta Asteraceae Helianthus
Organism Helianthus annuus (Sunflower)    [TaxId: 4232 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HaPrx67
start..stop
S start..stop
HaPrx101 512 0 1..329 1..326
HaPrx26 511 0 1..329 1..325
CsPrx10 500 2e-180 9..329 5..330
CclPrx35 499 5e-180 9..329 5..330
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 155604589..155604816 228 N° 2 155604297..155604494 198 N° 3 155603630..155604196 567  
complement(join(155603630..155604196,155604297..155604494,155604589..155604816))


exon

Literature and cross-references HaPrx67 (HanXRQChr09g0261221)
DNA ref. HanXRQ genome:   HanXRQChr09 (155604816..155603630)
Protein sequence: HaPrx67 (HanXRQChr09g0261221)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   330 (307)
PWM (Da):   %s   36132.99 (33608.8)  
PI (pH):   %s   8.32 (8.39) Peptide Signal:   %s   cut: 24 range:24-330
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAHSPNMTMMFIALLAQTTLCFAKITNGGYLYPQFYDRSCPQVTNIVRSIVAKAVAQDPRMAASLLRLHFHDCFVKGCDASILLDSGGARNVISEKGSIPNSNSARGFEVIDEIKAALETACPQTVSCADILALAARDSTVLSGGPSWEVPVGRRDSLGASLHGSNHNIPAPNNTFQTILTKFKIQGLDIVDLVALSGSHTIGNARCTSFKQRLYEKTGNEHTDKLFAAQLRMNCPQSGGDQNLFFLDNVTPMKFDNGYYKNLMESKGVLSSDQILFKENQESMELVKEYAANQDMFFQQFAKSMVKMGNISPLTGFRGQIRRSCRNVDG*

Retrieve as FASTA  
Remarks
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTCACTCACCAAACATGACCATGATGTTCATAGCTCTCCTGGCTCAAACCACCCTTTGCTTCGCTAAGATCACCAATGGAGGTTACCTCTATCCGCAATTCTATGATCGGTCTTGC
CCACAAGTCACCAACATAGTTCGCTCCATTGTTGCAAAAGCCGTTGCACAAGACCCACGCATGGCTGCGTCATTGCTTAGACTCCATTTCCATGATTGCTTCGTTAAG
GTTCGTGAACTA
CAATCTCTTCAAACTTCATTTTTTAATCATTTTGAGCTTATATATTCATGTTATTTGAAATGATCATATGTTATTTATCTAGGGATGTGATGCATCAATATTGTTAGACAGTGGCGGCGC
CAGGAATGTAATTAGCGAGAAAGGTTCCATTCCCAATAGCAACTCGGCTCGTGGATTTGAAGTCATTGATGAGATCAAAGCTGCACTGGAGACGGCCTGTCCACAGACCGTCTCCTGTGC
AGATATCCTGGCTCTAGCAGCTAGAGACTCTACAGTTTTG
GTACCGTAACCTAGCAATCTTAAAAAATATTAATATATCATACACACACTATACTTTATCAACCAAAAAAGTTGACTAAA
GGTTTATCTTGTATACACAGAGTGGCGGACCGAGTTGGGAAGTCCCGGTTGGAAGAAGAGACTCACTAGGTGCAAGCTTGCATGGATCTAACCACAACATTCCCGCTCCAAACAACACTT
TCCAAACCATCCTCACCAAGTTCAAGATCCAAGGTCTTGATATCGTCGATCTTGTAGCGCTTTCAGGAAGTCACACTATTGGAAATGCTAGGTGCACCAGCTTCAAGCAAAGGCTATATG
AAAAAACCGGCAATGAGCATACCGATAAACTGTTTGCAGCACAGTTGCGCATGAACTGCCCGCAATCAGGTGGTGACCAGAACCTGTTTTTTCTGGACAATGTGACCCCTATGAAGTTTG
ATAACGGGTACTACAAGAACTTGATGGAGTCAAAGGGGGTTTTGAGTTCGGATCAAATCTTGTTTAAGGAAAACCAGGAATCTATGGAGCTTGTGAAAGAATATGCTGCAAATCAAGACA
TGTTTTTTCAACAGTTTGCGAAATCAATGGTTAAGATGGGGAATATTAGTCCATTGACAGGATTCAGAGGACAGATCAGAAGAAGTTGTAGGAATGTCGACGGTTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTCACTCACCAAACATGACCATGATGTTCATAGCTCTCCTGGCTCAAACCACCCTTTGCTTCGCTAAGATCACCAATGGAGGTTACCTCTATCCGCAATTCTATGATCGGTCTTGC
CCACAAGTCACCAACATAGTTCGCTCCATTGTTGCAAAAGCCGTTGCACAAGACCCACGCATGGCTGCGTCATTGCTTAGACTCCATTTCCATGATTGCTTCGTTAAG
GGATGTGATGCA
TCAATATTGTTAGACAGTGGCGGCGCCAGGAATGTAATTAGCGAGAAAGGTTCCATTCCCAATAGCAACTCGGCTCGTGGATTTGAAGTCATTGATGAGATCAAAGCTGCACTGGAGACG
GCCTGTCCACAGACCGTCTCCTGTGCAGATATCCTGGCTCTAGCAGCTAGAGACTCTACAGTTTTG
AGTGGCGGACCGAGTTGGGAAGTCCCGGTTGGAAGAAGAGACTCACTAGGTGCA
AGCTTGCATGGATCTAACCACAACATTCCCGCTCCAAACAACACTTTCCAAACCATCCTCACCAAGTTCAAGATCCAAGGTCTTGATATCGTCGATCTTGTAGCGCTTTCAGGAAGTCAC
ACTATTGGAAATGCTAGGTGCACCAGCTTCAAGCAAAGGCTATATGAAAAAACCGGCAATGAGCATACCGATAAACTGTTTGCAGCACAGTTGCGCATGAACTGCCCGCAATCAGGTGGT
GACCAGAACCTGTTTTTTCTGGACAATGTGACCCCTATGAAGTTTGATAACGGGTACTACAAGAACTTGATGGAGTCAAAGGGGGTTTTGAGTTCGGATCAAATCTTGTTTAAGGAAAAC
CAGGAATCTATGGAGCTTGTGAAAGAATATGCTGCAAATCAAGACATGTTTTTTCAACAGTTTGCGAAATCAATGGTTAAGATGGGGAATATTAGTCCATTGACAGGATTCAGAGGACAG
ATCAGAAGAAGTTGTAGGAATGTCGACGGTTAA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTTTATTC ATAATAATTA GAAGTCATAA CACAACCCCT CCATTGTGTA TAAGTATTAG CCAAACTTCT ACAAGACTAC ACTAGTCTTG GGCTCGAACC ATATAACCAA ATCACAAAAA  TGGCTCACTC ACCAAACATG ACCATGATGT TCATAGCTCT CCTGGCTCAA ACCACCCTTT GCTTCGCTAA GATCACCAAT GGAGGTTACC TCTATCCGCA ATTCTATGAT CGGTCTTGCC  CACAAGTCAC CAACATAGTT CGCTCCATTG TTGCAAAAGC CGTTGCACAA GACCCACGCA TGGCTGCGTC ATTGCTTAGA CTCCATTTCC ATGATTGCTT CGTTAAGGGA TGTGATGCAT  CAATATTGTT AGACAGTGGC GGCGCCAGGA ATGTAATTAG CGAGAAAGGT TCCATTCCCA ATAGCAACTC GGCTCGTGGA TTTGAAGTCA TTGATGAGAT CAAAGCTGCA CTGGAGACGG  CCTGTCCACA GACCGTCTCC TGTGCAGATA TCCTGGCTCT AGCAGCTAGA GACTCTACAG TTTTGAGTGG CGGACCGAGT TGGGAAGTCC CGGTTGGAAG AAGAGACTCA CTAGGTGCAA  GCTTGCATGG ATCTAACCAC AACATTCCCG CTCCAAACAA CACTTTCCAA ACCATCCTCA CCAAGTTCAA GATCCAAGGT CTTGATATCG TCGATCTTGT AGCGCTTTCA GGAAGTCACA  CTATTGGAAA TGCTAGGTGC ACCAGCTTCA AGCAAAGGCT ATATGAAAAA ACCGGCAATG AGCATACCGA TAAACTGTTT GCAGCACAGT TGCGCATGAA CTGCCCGCAA TCAGGTGGTG  ACCAGAACCT GTTTTTTCTG GACAATGTGA CCCCTATGAA GTTTGATAAC GGGTACTACA AGAACTTGAT GGAGTCAAAG GGGGTTTTGA GTTCGGATCA AATCTTGTTT AAGGAAAACC  AGGAATCTAT GGAGCTTGTG AAAGAATATG CTGCAAATCA AGACATGTTT TTTCAACAGT TTGCGAAATC AATGGTTAAG ATGGGGAATA TTAGTCCATT GACAGGATTC AGAGGACAGA  TCAGAAGAAG TTGTAGGAAT GTCGACGGTT AAAATTCGTG TTTTACTTGT TTAAATGGAG GGAACTTTTT ATATTCTGTT TATATAGTTG GATCCTATTA TGGATCAATA AAATACTGAA 
GTTACGTTAC ATAGAAACGA ATATCATGTA ATATCTTCAT CATTGCTATA TAAAGTTTTT GTTGGTTATT TTT 

Retrieve as FASTA