Entry information : HaPrx68 (HanXRQChr09g0269531)
Entry ID 13622
Creation 2016-05-02 (Christophe Dunand)
Last sequence changes 2016-05-02 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2017-11-23 (Catherine Mathe (Scipio))
Peroxidase information: HaPrx68 (HanXRQChr09g0269531)
Name (synonym) HaPrx68 (HanXRQChr09g0269531)
Class Class III peroxidase    [Orthogroup: Prx036]
Taxonomy Eukaryota Viridiplantae Streptophyta Asteraceae Helianthus
Organism Helianthus annuus (Sunflower)    [TaxId: 4232 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HaPrx68
start..stop
S start..stop
HaPrx30 620 0 1..351 26..387
LsaPrx30 513 0 20..351 22..357
VvPrx89 510 0 9..351 10..352
HaPrx02 507 0 4..351 6..356
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 186043433..186043717 285 N° 2 186044140..186044331 192 N° 3 186044425..186044590 166 N° 4 186044738..186045150 413
join(186043433..186043717,186044140..186044331,186044425..186044590,186044738..1 86045150)


exon

Literature and cross-references HaPrx68 (HanXRQChr09g0269531)
DNA ref. HanXRQ genome:   HanXRQChr09 (186043433..186045150)
Protein sequence: HaPrx68 (HanXRQChr09g0269531)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   351 (328)
PWM (Da):   %s   37769.56 (35286.3) Transmb domain:   %s   i5-27o
PI (pH):   %s   4.36 (4.36) Peptide Signal:   %s   cut: 24 range:24-351
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MGSLLYAIFMLMVVLLSNSICIAFPGFNFGRIGGGGGDGPFGGGQGYPGLFPEFYSFSCPQANGIVMSVLESVIAEEPRMAASLLRLHFHDCFVQGCDASVLLDDSEVFASEKNSGPNSNSIRGFEVIDEIKSKLEEACPETVSCADILALAARGSTVLSGGPNWELPLGRRDATQASLGDSNNNLPPPNSTIQNLITLFRQQGLDEVDLVSLSGAHTIGMARCTSFKQRLYNQDGNNQPDSTLEVTYYNDLKTVCPENGGDNNISPLDFASPARFDNTYFKLIILGKGLLTSDQVLLSGNVEETMFLVKAFAENDALFFDQFARSMVKMGNINPLTGYNGEVRKNCRIAN

Retrieve as FASTA  
Remarks
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGTTCCCTTCTCTACGCTATTTTCATGCTAATGGTTGTGCTCTTGTCCAACAGTATATGTATTGCTTTTCCGGGATTCAACTTTGGACGGATAGGTGGCGGAGGAGGAGATGGGCCT
TTTGGTGGCGGCCAAGGGTATCCTGGTCTTTTCCCCGAATTCTATAGTTTCTCATGCCCTCAAGCTAATGGCATTGTCATGTCTGTACTTGAGAGTGTCATTGCTGAAGAGCCAAGAATG
GCAGCTTCTCTATTAAGGCTTCATTTTCATGACTGCTTTGTTCAG
GTTGTTGGTTAAGTTTATTAACTTTTAGAGTTATTATTATTTTATTTATCGTTTATCTTTAAGTTCGTTTGTTAG
TCATAATTATATCTCTAGTTTGAATGTTAGGATAGTTATATTCACGTTTTATCATTGTCATTAGTTGATTAGCTTTATTAGGAGATTTGGTTTTCAGTTATTTAATACACTAGAAAATGT
TATTCACCACAGTTCGTTTGATGGGGCGCCCAACCCCCCGAACTTTTCGCTCAGTAGTGTCTGATATGTAGTTTTCGTATAGAATTTTTTAGGTATATATGTTTTCGACCCCCCTGTCGG
AAATCTCAAGCTTCGCCACTGATTGCGTAAATACAGTACCTTTTTTAATGATACATTATGTGACATTGATATTGTGAAACTGATAAGTTATGCTTGTTTTGTCTCAGGGATGTGATGCAT
CTGTCCTGTTGGATGACAGTGAAGTATTTGCAAGCGAAAAGAACTCCGGGCCTAACAGTAATTCGATTAGAGGTTTTGAAGTGATCGACGAGATCAAGTCTAAGCTAGAAGAAGCATGTC
CGGAGACCGTTTCTTGTGCAGACATCCTTGCCCTTGCTGCTCGAGGTTCCACTGTTCTA
GTATGCACTCAAACGTCATATCTTTCTATTCTAGCTAGTTGTTTTAATTATAAATGGCAAA
GTAACGAGTATTTGCTTGTAAATTCATCGTAGAGTGGTGGACCGAACTGGGAACTGCCCTTAGGAAGGAGGGATGCAACACAAGCAAGTCTGGGCGACTCAAACAACAACCTTCCGCCAC
CAAACTCTACCATTCAAAACCTTATAACACTTTTCCGGCAACAAGGCCTTGATGAAGTTGACCTGGTCTCTCTTTCTG
GTTAGGCAAAAACTGACAATCACTACAACATATATGTAAATC
TAACAAATTTAAATAATGAATTTTGTCTCATTAATATTATGTGTGTAGATATTATATCAAACAATAAAAAAGATGTTAGTGATGTGAGAGTTATCTTCATTTCAGGAGCTCATACCATAG
GAATGGCAAGATGTACTTCATTTAAGCAAAGGCTATACAATCAAGATGGCAACAATCAACCAGATTCAACTTTAGAGGTGACCTACTACAATGACTTAAAAACAGTGTGCCCAGAAAATG
GTGGGGACAACAACATTTCTCCTCTAGATTTTGCATCTCCAGCAAGATTCGATAACACATATTTCAAGCTCATTATCTTGGGAAAAGGACTTCTGACTTCTGATCAAGTGCTTCTGTCTG
GAAATGTTGAAGAAACCATGTTTCTGGTGAAAGCATTCGCCGAGAATGACGCGCTTTTCTTTGACCAGTTTGCTAGATCAATGGTGAAAATGGGAAACATTAATCCCCTCACTGGTTATA
ACGGCGAAGTGAGGAAGAACTGTCGAATAGCTAATTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGTTCCCTTCTCTACGCTATTTTCATGCTAATGGTTGTGCTCTTGTCCAACAGTATATGTATTGCTTTTCCGGGATTCAACTTTGGACGGATAGGTGGCGGAGGAGGAGATGGGCCT
TTTGGTGGCGGCCAAGGGTATCCTGGTCTTTTCCCCGAATTCTATAGTTTCTCATGCCCTCAAGCTAATGGCATTGTCATGTCTGTACTTGAGAGTGTCATTGCTGAAGAGCCAAGAATG
GCAGCTTCTCTATTAAGGCTTCATTTTCATGACTGCTTTGTTCAG
GGATGTGATGCATCTGTCCTGTTGGATGACAGTGAAGTATTTGCAAGCGAAAAGAACTCCGGGCCTAACAGTAAT
TCGATTAGAGGTTTTGAAGTGATCGACGAGATCAAGTCTAAGCTAGAAGAAGCATGTCCGGAGACCGTTTCTTGTGCAGACATCCTTGCCCTTGCTGCTCGAGGTTCCACTGTTCTA
AGT
GGTGGACCGAACTGGGAACTGCCCTTAGGAAGGAGGGATGCAACACAAGCAAGTCTGGGCGACTCAAACAACAACCTTCCGCCACCAAACTCTACCATTCAAAACCTTATAACACTTTTC
CGGCAACAAGGCCTTGATGAAGTTGACCTGGTCTCTCTTTCTG
GAGCTCATACCATAGGAATGGCAAGATGTACTTCATTTAAGCAAAGGCTATACAATCAAGATGGCAACAATCAACCA
GATTCAACTTTAGAGGTGACCTACTACAATGACTTAAAAACAGTGTGCCCAGAAAATGGTGGGGACAACAACATTTCTCCTCTAGATTTTGCATCTCCAGCAAGATTCGATAACACATAT
TTCAAGCTCATTATCTTGGGAAAAGGACTTCTGACTTCTGATCAAGTGCTTCTGTCTGGAAATGTTGAAGAAACCATGTTTCTGGTGAAAGCATTCGCCGAGAATGACGCGCTTTTCTTT
GACCAGTTTGCTAGATCAATGGTGAAAATGGGAAACATTAATCCCCTCACTGGTTATAACGGCGAAGTGAGGAAGAACTGTCGAATAGCTAATTAA

Retrieve as FASTA