Entry information : HaPrx69 (HanXRQChr10g0278571)
Entry ID 13623
Creation 2016-05-02 (Christophe Dunand)
Last sequence changes 2016-05-02 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2017-11-23 (Catherine Mathe (Scipio))
Peroxidase information: HaPrx69 (HanXRQChr10g0278571)
Name (synonym) HaPrx69 (HanXRQChr10g0278571)
Class Class III peroxidase    [Orthogroup: Prx269]
Taxonomy Eukaryota Viridiplantae Streptophyta Asteraceae Helianthus
Organism Helianthus annuus (Sunflower)    [TaxId: 4232 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HaPrx69
start..stop
S start..stop
HaPrx32 585 0 3..362 2..359
HaPrx53 576 0 1..362 1..358
LsaPrx24 484 8.81e-174 9..308 1..298
GrPrx32 474 4.48e-169 39..354 33..345
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '13623' 'join(5116769..5117032,5117861..5118058,5119490..5120116)' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 5116769..5117032 262 N° 2 5117861..5118058 196 N° 3 5119490..5120116 625  
join(5116769..5117032,5117861..5118058,5119490..5120116)


exon

Literature and cross-references HaPrx69 (HanXRQChr10g0278571)
DNA ref. HanXRQ genome:   HanXRQChr10 (5116769..5120116)
Protein sequence: HaPrx69 (HanXRQChr10g0278571)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   362 (274)
PWM (Da):   %s   39462.19 (30175.1)  
PI (pH):   %s   8.79 (8.65) Peptide Signal:   %s   cut: 0 range:Ymax-273
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MGGSKMTLVPSHTVKLTLGVLVVVMLMHLKCLEAQQQQLVEGLSWKFYESKCPKLESIIRKQMVKVIKKDVGLAAALLRLHFHDCFVQMGGSKMTLVPSHTVKLTLGVLVVVMLMHLKCL
EAQQQQLVEGLSWKFYESKCPKLESIIRKQMVKVIKKDVGLA
AALLRLHFHDCFVQ
GCDGSVLLDGSASGPADSEKTAPPNLRLRGFDVIEDLRRRVHKQCGAGSVSCSDITAIVARDTI
VL
TGGPKYNVPLGRRDGLTFATRNATLSNLPSPFVPVDKLLPDFAARNFDATDVVALSGAHTIGVAHCTSFTQRLYPTQDTTMDKTFASTLKRVCPTATTNATTSLDVRSPNTFDNKYFV
DLMNKQGVLTPDQDLYTDKRTRSIVTSFAVNQTLFFEKFVNAMVKMSQMQVLTGTQGEIRNNCSRRNANTYDPLISTVVGDADVDSAQSF*

Retrieve as FASTA  
Remarks
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGTGGTTCTAAAATGACATTAGTGCCCTCTCACACTGTTAAACTGACTTTGGGTGTGTTGGTAGTAGTGATGTTAATGCATTTGAAGTGTTTAGAAGCACAACAACAGCAGTTAGTG
GAGGGGCTTTCTTGGAAATTCTATGAAAGTAAGTGTCCAAAGTTGGAATCAATTATTAGAAAGCAAATGGTGAAGGTGATCAAGAAGGATGTTGGTCTTGCTGCTGCTCTTTTGAGACTT
CATTTCCATGATTGCTTTGTTCAG
AGGTATACATGGTTCAAAAGTCGCTAAGCGCTCCCTAATCGGTCAACCGGGGAGTTGAGAGTACTCGGACATGTTAAATTATAAAGAAATTAGTTT
TCGCAAATTAAATATATGTCAATAACATAAATTTACTAATATTTGTAACAAAATACAGAAAAATGATATTTATTCTTTAATATGATAGATATAGAAGTACATAAATTATTATTTTTTTAA
GTCAAACTCGGCCCGAGTTGACCTACTAGATACGATTTTGGCCGAGGTTGACCGCGTTTGATCGATTCCGATTGATTAGGCGGAGTTGAAGAAAAGTCGTCTCTGCAGCATGTCTTGTAG
CGATTACTCGGGGAGTACTCGGCCTTGGACAGTGGCGAAGCTTGAGATTTCCGACCGAGGGGGGGCGGTCGAAAACGTATATACCTAAAAATTTCTATAGAACCGGGGGGTCGAAAACGT
ATATACCCAAAATTTTCTATACGAAAGCTACATACATCTAACTCTACTGAGCGAAAAGTTCGAGGGTCCCCCCCCCCCCTCTAACCTACGCCCCTAGCATTAGAGACCTTGTTTTACAAC
CATATTTCTATGGTTATGAGATATGTGAAATTTCATGTATCTGCTTTAGCTCTGTATACCATTAGAAAGGTTTCAAACTTGGCCCACTTTTTATATATACATGAATAACTTTATCGACTA
TATATTTTCAAAGTGAGTCGATATGAATTTCGTACCACTTAAGAGCATCTTCAATAGTGTGACAATTTCATGCCTTATATTAGAATTTGTAGCGTTTATATCCGCATATCTCATTATAAC
GTTGTCAACAACAGGGTTGCGATGGCTCGGTGCTATTGGATGGATCAGCAAGCGGCCCGGCTGATAGTGAGAAAACCGCACCACCAAACCTACGTTTGAGGGGGTTCGATGTCATCGAGG
ATCTTCGTCGTAGGGTTCACAAACAATGTGGTGCGGGTAGTGTCTCGTGTTCGGATATCACTGCCATTGTTGCACGGGACACAATTGTCTTG
TGGTAAATCCTTTTTTTTTTTTTTTTTG
AAAAGTAAAAAAAAATTAAATAATTATACACCTCTTTTCGCTCCATTTTGATTATGTTTAATTACTTTTATTTTACAATAATACAATCAAATAATTTTTAAACTTACAAACTAATGAAAC
GAGAGATAATCTAATTATTTAACTTCTTTTGTTAAGATCCATCATATAATAAAACAGTTTTATAAATTAAAACAAAAGTATTTACTGAGTTCATTTATTTATAGTACGGTAAAAGTACGG
GTTAAATGGGTTGAATTTATAAACGTGCACAACACTTGTATTTCTTCTCGTCGTTGACATCAACCCTAACTCGGATATACTTAAAATCATGCAATTTGAGCATGACATGGTTAACACATT
TATTAAATAGGGTGCAAACAACGAGCCGAGTCCGAGCTCGACTGGACTCAAGCTCAAGCCCGTTTAACTTATTTGAGCTCGAGCTCGGTTCGATTCGAACTTTTTTTACAAGGCTCGAGC
TCGGCTCATAGATAGTTTTTCAACCTCGGGCTCGGCTCGTTTATTATTTATTAATTAATTTATATTAACTATAATTAACCTTTTATATATAATTAAGTTATTTATTTCATAATTTTATAA
ATAGTAATTATTACTATTTAAAATATATATTTAATATATTATAATGTTATATAAACAATGGGCTCGTTTATGCTTGCGACCCGGCAGAGCTCGGTCTCGTTTCCTAAACGAGTTTGTTTC
TAGGCCCCAGCTCGGGTTCATTTAAGCTCGGCTTATTTCGAGCATTTTTTCGAGCCGAACTCGAGTAGCTCACAAGTAGCTCGGCTCGTTTGCACCCCTATTAATTAACAAGTAAAACGG
GTTGGCAGGTTGTAAATGATGTGTAATCAAGTTTATGCATGTGTTAAGTCATAAACGGGTTTACTAGATGTAATAAATGGGTTAATTGAGTCGTCAATGAGTTGGTGGGTTGACCTTATA
TAACATGGATTTAATTTTTATTATAAATTTAAATAAGTTGAAGTGTTAATTAAACGAGTTAAAAATGTTAACCCGGACATGATCTATTTACTAAATACCACTTGTTATTACAAAGGATAT
GAATAATAACTAACTAATAACCTGATTATTTGTGTATCATGTCAATAATTTACGACTTGCACTCAAACAAGGTTTATAACGAAATGACCACATGTTCGTTATAGCCACTGTGTAGGTTTA
TAACGAAACGCGACCACATGTCCGGTATAGTTTGTTCGCTACATTGTAAGAGTGTAGCGAACACCCTTCATACTTCTAATGTAACAAACACTACACATAAAAATGTCTTAAAAACATATA
TCACGCAAACATGCACAAACACATACAAAGTGTCAAATAGTTTACATAAACTAACATAGTTTTTGTATATTATGTTGTTTATTAGACTGGTGGTCCAAAGTACAACGTTCCTCTAGGTCG
AAGAGATGGACTCACATTTGCCACAAGAAACGCAACCCTTTCCAATCTTCCATCACCATTCGTCCCAGTCGACAAGCTACTCCCCGACTTCGCAGCCAGAAACTTCGACGCCACTGATGT
CGTGGCCCTATCCGGGGCCCACACCATCGGTGTCGCCCATTGCACATCCTTCACACAACGCCTTTACCCTACACAGGACACAACCATGGACAAAACCTTTGCCAGCACCCTCAAGCGCGT
ATGCCCAACCGCCACCACCAATGCCACCACGTCCTTAGACGTTCGCTCTCCAAACACGTTCGACAACAAGTACTTTGTCGACCTCATGAACAAACAAGGCGTTCTGACACCGGACCAAGA
CTTGTACACCGACAAACGGACACGAAGCATTGTCACTAGCTTTGCGGTTAATCAAACATTGTTTTTCGAGAAATTCGTCAACGCTATGGTAAAAATGAGCCAAATGCAAGTGCTGACCGG
CACACAAGGGGAGATTCGCAACAATTGTTCCAGGCGAAACGCAAACACATACGACCCGCTCATATCGACTGTCGTCGGTGACGCTGACGTGGACAGCGCACAAAGCTTCTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGTGGTTCTAAAATGACATTAGTGCCCTCTCACACTGTTAAACTGACTTTGGGTGTGTTGGTAGTAGTGATGTTAATGCATTTGAAGTGTTTAGAAGCACAACAACAGCAGTTAGTG
GAGGGGCTTTCTTGGAAATTCTATGAAAGTAAGTGTCCAAAGTTGGAATCAATTATTAGAAAGCAAATGGTGAAGGTGATCAAGAAGGATGTTGGTCTTGCTGCTGCTCTTTTGAGACTT
CATTTCCATGATTGCTTTGTTCAG
GGTTGCGATGGCTCGGTGCTATTGGATGGATCAGCAAGCGGCCCGGCTGATAGTGAGAAAACCGCACCACCAAACCTACGTTTGAGGGGGTTCGAT
GTCATCGAGGATCTTCGTCGTAGGGTTCACAAACAATGTGGTGCGGGTAGTGTCTCGTGTTCGGATATCACTGCCATTGTTGCACGGGACACAATTGTCTTG
ACTGGTGGTCCAAAGTAC
AACGTTCCTCTAGGTCGAAGAGATGGACTCACATTTGCCACAAGAAACGCAACCCTTTCCAATCTTCCATCACCATTCGTCCCAGTCGACAAGCTACTCCCCGACTTCGCAGCCAGAAAC
TTCGACGCCACTGATGTCGTGGCCCTATCCGGGGCCCACACCATCGGTGTCGCCCATTGCACATCCTTCACACAACGCCTTTACCCTACACAGGACACAACCATGGACAAAACCTTTGCC
AGCACCCTCAAGCGCGTATGCCCAACCGCCACCACCAATGCCACCACGTCCTTAGACGTTCGCTCTCCAAACACGTTCGACAACAAGTACTTTGTCGACCTCATGAACAAACAAGGCGTT
CTGACACCGGACCAAGACTTGTACACCGACAAACGGACACGAAGCATTGTCACTAGCTTTGCGGTTAATCAAACATTGTTTTTCGAGAAATTCGTCAACGCTATGGTAAAAATGAGCCAA
ATGCAAGTGCTGACCGGCACACAAGGGGAGATTCGCAACAATTGTTCCAGGCGAAACGCAAACACATACGACCCGCTCATATCGACTGTCGTCGGTGACGCTGACGTGGACAGCGCACAA
AGCTTCTAA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
CATAGTGTTA AGCAATGGGT GGTTCTAAAA TGACATTAGT GCCCTCTCAC ACTGTTAAAC TGACTTTGGG TGTGTTGGTA GTAGTGATGT TAATGCATTT GAAGTGTTTA GAAGCACAAC  AACAGCAGTT AGTGGAGGGG CTTTCTTGGA AATTCTATGA AAGTAAGTGT CCAAAGTTGG AATCAATTAT TAGAAAGCAA ATGGTGAAGG TGATCAAGAA GGATGTTGGT CTTGCTGCTG  CTCTTTTGAG ACTTCATTTC CATGATTGCT TTGTTCAGGG TTGCGATGGC TCGGTGCTAT TGGATGGATC AGCAAGCGGC CCGGCTGATA GTGAGAAAAC CGCACCACCA AACCTACGTT  TGAGGGGGTT CGATGTCATC GAGGATCTTC GTCGTAGGGT TCACAAACAA TGTGGTGCGG GTAGTGTCTC GTGTTCGGAT ATCACTGCCA TTGTTGCACG GGACACAATT GTCTTGACTG  GTGGTCCAAA GTACAACGTT CCTCTAGGTC GAAGAGATGG ACTCACATTT GCCACAAGAA ACGCAACCCT TTCCAATCTT CCATCACCAT TCGTCCCAGT CGACAAGCTA CTCCCCGACT  TCGCAGCCAG AAACTTCGAC GCCACTGATG TCGTGGCCCT ATCCGGGGCC CACACCATCG GTGTCGCCCA TTGCACATCC TTCACACAAC GCCTTTACCC TACACAGGAC ACAACCATGG  ACAAAACCTT TGCCAGCACC CTCAAGCGCG TATGCCCAAC CGCCACCACC AATGCCACCA CGTCCTTAGA CGTTCGCTCT CCAAACACGT TCGACAACAA GTACTTTGTC GACCTCATGA  ACAAACAAGG CGTTCTGACA CCGGACCAAG ACTTGTACAC CGACAAACGG ACACGAAGCA TTGTCACTAG CTTTGCGGTT AATCAAACAT TGTTTTTCGA GAAATTCGTC AACGCTATGG  TAAAAATGAG CCAAATGCAA GTGCTGACCG GCACACAAGG GGAGATTCGC AACAATTGTT CCAGGCGAAA CGCAAACACA TACGACCCGC TCATATCGAC TGTCGTCGGT GACGCTGACG  TGGACAGCGC ACAAAGCTTC TAACGCTTTC AACTTTGAAC CAATAAATAT ATCGTTAGAA TGTTTTATGA TAATATGATG TACTGGCACT TGATGGAAAC TAATAACGGG TGGAATCGTA 
TGTGATATAT AACGTTAACT TT 

Retrieve as FASTA