Entry information : HaPrx71 ( HanXRQChr10g0286351.1)
Entry ID 13625
Creation 2016-05-02 (Christophe Dunand)
Last sequence changes 2016-05-02 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2017-11-23 (Catherine Mathe (Scipio))
Peroxidase information: HaPrx71 ( HanXRQChr10g0286351.1)
Name (synonym) HaPrx71 ( HanXRQChr10g0286351.1)
Class Class III peroxidase    [Orthogroup: Prx040]
Taxonomy Eukaryota Viridiplantae Streptophyta Asteraceae Helianthus
Organism Helianthus annuus (Sunflower)    [TaxId: 4232 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HaPrx71
start..stop
S start..stop
HaPrx40 603 0 28..321 70..363
HaPrx73 556 0 4..321 1..318
HaPrx132 546 0 1..321 1..321
HaPrx[P]70 545 0 1..321 1..321
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 46264795..46265016 222 N° 2 46263932..46264126 195 N° 3 46263195..46263743 549  
complement(join(46263195..46263743,46263932..46264126,46264795..46265016))


exon

Literature and cross-references HaPrx71 ( HanXRQChr10g0286351.1)
DNA ref. HanXRQ genome:   HanXRQChr10 (46265016..46263195)
Protein sequence: HaPrx71 ( HanXRQChr10g0286351.1)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   322 (296)
PWM (Da):   %s   34911.42 (32025.9)  
PI (pH):   %s   4.79 (4.70) Peptide Signal:   %s   cut: 26 range:26-321
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MEKMNIRSLLYLFVSLISCIATASSNSGLSSHYYDRICPEALPTIKRVVEDALAQEQRMGASLLRLHFHDCFVNGCDGSILLDQTPTIDSEKNAAPNANSARGFEVIDKIKDEVDKVCGRPVVSCADILAVAARDSVVALGGPSWKVRLGRRDSTTASQSAANANIPAPSMNLPALIKNFEDQGLDEEDLVVLSGAHTLGFAQCRNFRDRIYNETNIDPAFVSHLQTICPQVGGDSRLAPLDPTPNSFDVKYFSSLASKKGLLSSDQALLDGGETAELVLKYSGDAEEFWEDFAESMIKMGDIKPLTGNRGEIRNDCRKVN*

Retrieve as FASTA  
Remarks
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGAGAAGATGAACATCAGAAGTTTATTATATCTTTTTGTTTCTCTCATTTCTTGTATTGCCACCGCATCCTCAAACTCAGGTTTGTCATCACATTATTATGATCGCATATGCCCTGAA
GCTCTTCCGACCATCAAACGTGTGGTGGAGGATGCATTGGCACAAGAGCAACGCATGGGTGCATCTCTATTACGTCTGCATTTTCATGATTGTTTTGTTAAT
GTAAGTAATTTATTCCTA
CCAATTTATATTTGAGATTTCATACTTGGATATCCGGAGCAAAGACATATTTTTTTTTTGCCATCGAAACGCCTAAGAATTAAAGTATTACAAATTAAGTTTTGTTAAGTTTATATTATG
ATTGTTTTGTTAATGCTTGTTGAACTAATACATTTAGTTTAGTCTTACAAATTAAGTTTAGAAAACGATTAAAAGCAAGTATCCTAAGAATTAAAGTATTCAAACTTGATAAAAACTAGA
GCAGTTTTGCATGTTATTAAAGTTCAATGCAAGCATTTTTCTTAAAGTTCTTCTCTCCATGTAAACAGTAAAAATATTTGTTTGTTATTTGATTAAACATGTAACTTCCACATATAAATT
GTGCTTTAACATTCATGATTTACAATAAATTGGTACTTGAATTTAACTATAGATGCTTAATAAATATAGAAATCAAAAACTTTTATCATGATTTAGAAATAAAAGTTTTATTTTCTTACG
TAAAATATACTTTCCGTTATACTTAATGATGCACACTTGAAAGGGAAGAACAAGGCGCTGCAAAATGAAGTGTTATCTTGTAGAATATAAGGGAGTAGAAAGTGTTGGTGTTGTTTTATG
AATAGAAAGTGATGGTGTTGTTTTTTGAGTATATTTTTTTAATCTTGTAGGGATGTGATGGTTCCATTCTTTTGGATCAAACACCTACAATAGACAGCGAGAAAAATGCAGCTCCGAACG
CAAATTCAGCTAGAGGATTCGAGGTTATTGACAAAATCAAGGATGAGGTCGACAAAGTTTGTGGCCGCCCGGTGGTGTCATGTGCAGATATCTTAGCTGTTGCCGCTCGTGATTCTGTTG
TTGCG
GTAAGTGATTGCGATTGTTAACATACACCTAGAGAGTAAAAATTCTCACTTTCATTGAGTTGAAAAAAAATCATGAATGTGTCCCTCTTTAACAATTTTTTGTAATGATGAAAAC
AAATAAAAGAAATAAAATTTTAGCGTGACAAACATATTATTTGTGTAAATCTAAATCTTTTTATGGTTTGCAGCTTGGTGGCCCATCATGGAAAGTCAGGCTCGGAAGAAGAGACTCAAC
CACCGCTAGCCAAAGCGCAGCTAACGCTAACATCCCGGCACCGTCCATGAACTTACCTGCCCTTATAAAAAACTTTGAGGACCAAGGGCTCGACGAGGAGGACTTAGTTGTGCTTTCAGG
AGCACACACCTTAGGGTTTGCTCAGTGTCGAAACTTTAGGGATCGTATTTACAACGAGACCAACATTGATCCAGCCTTCGTGAGCCACCTTCAGACCATTTGTCCACAAGTTGGGGGCGA
CTCAAGGCTCGCACCACTTGACCCGACACCAAACTCGTTTGATGTGAAATACTTTTCCAGTTTGGCGAGTAAAAAAGGACTTTTGAGCTCTGATCAAGCACTCTTGGATGGTGGTGAAAC
TGCTGAACTTGTTTTGAAATACAGTGGGGACGCCGAAGAGTTCTGGGAGGATTTTGCAGAGTCTATGATTAAAATGGGTGATATAAAGCCATTAACAGGGAATAGAGGTGAAATTCGCAA
CGATTGTAGAAAAGTTAATTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGAGAAGATGAACATCAGAAGTTTATTATATCTTTTTGTTTCTCTCATTTCTTGTATTGCCACCGCATCCTCAAACTCAGGTTTGTCATCACATTATTATGATCGCATATGCCCTGAA
GCTCTTCCGACCATCAAACGTGTGGTGGAGGATGCATTGGCACAAGAGCAACGCATGGGTGCATCTCTATTACGTCTGCATTTTCATGATTGTTTTGTTAAT
GGATGTGATGGTTCCATT
CTTTTGGATCAAACACCTACAATAGACAGCGAGAAAAATGCAGCTCCGAACGCAAATTCAGCTAGAGGATTCGAGGTTATTGACAAAATCAAGGATGAGGTCGACAAAGTTTGTGGCCGC
CCGGTGGTGTCATGTGCAGATATCTTAGCTGTTGCCGCTCGTGATTCTGTTGTTGCG
CTTGGTGGCCCATCATGGAAAGTCAGGCTCGGAAGAAGAGACTCAACCACCGCTAGCCAAAGC
GCAGCTAACGCTAACATCCCGGCACCGTCCATGAACTTACCTGCCCTTATAAAAAACTTTGAGGACCAAGGGCTCGACGAGGAGGACTTAGTTGTGCTTTCAGGAGCACACACCTTAGGG
TTTGCTCAGTGTCGAAACTTTAGGGATCGTATTTACAACGAGACCAACATTGATCCAGCCTTCGTGAGCCACCTTCAGACCATTTGTCCACAAGTTGGGGGCGACTCAAGGCTCGCACCA
CTTGACCCGACACCAAACTCGTTTGATGTGAAATACTTTTCCAGTTTGGCGAGTAAAAAAGGACTTTTGAGCTCTGATCAAGCACTCTTGGATGGTGGTGAAACTGCTGAACTTGTTTTG
AAATACAGTGGGGACGCCGAAGAGTTCTGGGAGGATTTTGCAGAGTCTATGATTAAAATGGGTGATATAAAGCCATTAACAGGGAATAGAGGTGAAATTCGCAACGATTGTAGAAAAGTT
AATTAA

Retrieve as FASTA