Entry information : HaPrx72 (HanXRQChr10g0286371)
Entry ID 13626
Creation 2016-05-02 (Christophe Dunand)
Last sequence changes 2016-05-02 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2017-11-23 (Catherine Mathe (Scipio))
Peroxidase information: HaPrx72 (HanXRQChr10g0286371)
Name (synonym) HaPrx72 (HanXRQChr10g0286371)
Class Class III peroxidase    [Orthogroup: Prx013]
Taxonomy Eukaryota Viridiplantae Streptophyta Asteraceae Helianthus
Organism Helianthus annuus (Sunflower)    [TaxId: 4232 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HaPrx72
start..stop
S start..stop
HaPrx71 537 0 1..317 4..321
HaPrx73 535 0 1..317 1..318
HaPrx40 517 0 24..317 70..363
HaPrx132 513 0 17..317 21..321
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 46311712..46311921 210 N° 2 46311073..46311267 195 N° 3 46310384..46310944 561  
complement(join(46310384..46310944,46311073..46311267,46311712..46311921))


exon

Literature and cross-references HaPrx72 (HanXRQChr10g0286371)
DNA ref. HanXRQ genome:   HanXRQChr10 (46311921..46310384)
Protein sequence: HaPrx72 (HanXRQChr10g0286371)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   321 (302)
PWM (Da):   %s   35091.11 (33112.0)  
PI (pH):   %s   9.32 (9.32) Peptide Signal:   %s   cut: 20 range:20-321
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MNAISFLSLVSLIFSIATAALNSGLSSSYYDRVCPEALPTIKRVVEDALAQERRMGASLLRLHFHDCFVNGCDASILLDQTSTIHSEKNALPNANSVRGFEVIDKIKFEVDKVCGRPVVSCADILAVAARDSVVALGGPSWKVKLGRRDSTTASRTAANANLPSPFMDLPALIKNFKDQGLDKEDLVVLSGAHTLGFAQCFTFRDRIHNETNIHPAFASHLRTICPQVGANSRLAPLDSTPGSFDVKYFTNLVSKKGILRSDQALFDGGVTNELVSKYIRNQKEFWADFAKSMVKMGDIKPLTGNRGQIRNMCRKTNFKKY*

Retrieve as FASTA  
Remarks
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAATGCCATAAGCTTCTTATCTCTTGTTTCTCTCATTTTTTCTATTGCCACCGCAGCTTTAAACTCGGGTTTGTCATCAAGTTATTATGATCGAGTGTGTCCAGAGGCCCTCCCGACT
ATCAAACGTGTGGTGGAGGATGCATTGGCACAAGAACGCCGCATGGGTGCTTCTCTTTTACGTCTTCATTTTCATGATTGTTTTGTTAAC
GTAAGTAACTTAACAAAGTTATATATTTGC
GACAGAAATGACTAGCTTGTTTTTAACCAATGTTACATCCTTAGAATAATCAAAATCGCGGCTTGGTTATAAATAAAATATAGTAAACGATTTCAAACAAGTCTTTAACTTATTTGATAA
CAACCATAAACATTTTTCCTGAAGTTCTTCAACCAAAATTGAAGTTTTTTTTTGTATGTTATTTGATTAAACATTAGAATTTCACATATAGATTATGTTTCATATTTACAAATTCAGCAA
ATACCAATTTAACTCAACTACTGAGAAATCACAAACTTCAATTACTGCTTCTCAATTTGGCAGGACCTATGATTTTTTTATGTTGAATATTTAGGTTGAAAAAACAGGTGTTAACTTGTC
GCACATTGAAAGTATTGGTTTTGTTTTACTGACTTTATTTTTTATATCACATAGGGATGTGATGCTTCCATTCTTTTGGATCAAACATCAACAATACATAGTGAGAAAAATGCACTCCCC
AACGCAAATTCGGTCAGAGGATTTGAGGTTATTGACAAAATCAAGTTTGAGGTCGACAAAGTTTGCGGTCGTCCCGTTGTGTCGTGTGCTGATATCTTAGCTGTTGCTGCTCGTGATTCT
GTCGTTGCG
GTAAGTAAAACATACTGATGAAAATAAAAAATAAGAAGTTGTAGGATAATGCATAGTGTGATGGAAAAATTTTAAATTTGTGAAGAGTTTAATTACTTTTCTCATATATAT
ATATATATGGTTTGTAGCTTGGTGGGCCATCGTGGAAAGTCAAGCTTGGAAGAAGAGACTCAACCACCGCTAGTCGGACCGCAGCTAACGCAAACCTCCCGTCACCATTCATGGACTTAC
CCGCCCTTATAAAAAACTTCAAGGACCAAGGGCTTGATAAAGAGGACTTGGTTGTGCTTTCGGGTGCACACACCCTAGGGTTTGCTCAGTGTTTTACCTTTAGGGATCGTATTCACAATG
AGACCAACATTCATCCAGCCTTTGCGAGCCACCTTCGGACCATTTGTCCACAAGTTGGGGCCAACTCAAGGCTCGCACCACTTGACTCAACACCTGGCTCGTTTGACGTGAAATACTTCA
CCAATTTGGTGAGTAAAAAGGGAATTTTGAGATCTGATCAAGCACTTTTTGATGGTGGCGTAACTAATGAGCTTGTTTCAAAATATATTCGGAACCAAAAAGAGTTTTGGGCGGATTTTG
CAAAGTCTATGGTTAAAATGGGTGATATAAAACCATTAACAGGGAACAGAGGTCAAATTCGCAACATGTGTAGGAAAACTAATTTCAAGAAATATTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAATGCCATAAGCTTCTTATCTCTTGTTTCTCTCATTTTTTCTATTGCCACCGCAGCTTTAAACTCGGGTTTGTCATCAAGTTATTATGATCGAGTGTGTCCAGAGGCCCTCCCGACT
ATCAAACGTGTGGTGGAGGATGCATTGGCACAAGAACGCCGCATGGGTGCTTCTCTTTTACGTCTTCATTTTCATGATTGTTTTGTTAAC
GGATGTGATGCTTCCATTCTTTTGGATCAA
ACATCAACAATACATAGTGAGAAAAATGCACTCCCCAACGCAAATTCGGTCAGAGGATTTGAGGTTATTGACAAAATCAAGTTTGAGGTCGACAAAGTTTGCGGTCGTCCCGTTGTGTCG
TGTGCTGATATCTTAGCTGTTGCTGCTCGTGATTCTGTCGTTGCG
CTTGGTGGGCCATCGTGGAAAGTCAAGCTTGGAAGAAGAGACTCAACCACCGCTAGTCGGACCGCAGCTAACGCA
AACCTCCCGTCACCATTCATGGACTTACCCGCCCTTATAAAAAACTTCAAGGACCAAGGGCTTGATAAAGAGGACTTGGTTGTGCTTTCGGGTGCACACACCCTAGGGTTTGCTCAGTGT
TTTACCTTTAGGGATCGTATTCACAATGAGACCAACATTCATCCAGCCTTTGCGAGCCACCTTCGGACCATTTGTCCACAAGTTGGGGCCAACTCAAGGCTCGCACCACTTGACTCAACA
CCTGGCTCGTTTGACGTGAAATACTTCACCAATTTGGTGAGTAAAAAGGGAATTTTGAGATCTGATCAAGCACTTTTTGATGGTGGCGTAACTAATGAGCTTGTTTCAAAATATATTCGG
AACCAAAAAGAGTTTTGGGCGGATTTTGCAAAGTCTATGGTTAAAATGGGTGATATAAAACCATTAACAGGGAACAGAGGTCAAATTCGCAACATGTGTAGGAAAACTAATTTCAAGAAA
TATTAA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
CAGCACAAGA CCACAATAAC ATTACACAAC ACAAAGATAT TGTACCTGAA AAAATCCATT TGGTCACCAA CTATAGAGAA GATATGAATG CCATAAGCTT CTTATCTCTT GTTTCTCTCA  TTTTTTCTAT TGCCACCGCA GCTTTAAACT CGGGTTTGTC ATCAAGTTAT TATGATCGAG TGTGTCCAGA GGCCCTCCCG ACTATCAAAC GTGTGGTGGA GGATGCATTG GCACAAGAAC  GCCGCATGGG TGCTTCTCTT TTACGTCTTC ATTTTCATGA TTGTTTTGTT AACGGATGTG ATGCTTCCAT TCTTTTGGAT CAAACATCAA CAATACATAG TGAGAAAAAT GCACTCCCCA  ACGCAAATTC GGTCAGAGGA TTTGAGGTTA TTGACAAAAT CAAGTTTGAG GTCGACAAAG TTTGCGGTCG TCCCGTTGTG TCGTGTGCTG ATATCTTAGC TGTTGCTGCT CGTGATTCTG  TCGTTGCGCT TGGTGGGCCA TCGTGGAAAG TCAAGCTTGG AAGAAGAGAC TCAACCACCG CTAGTCGGAC CGCAGCTAAC GCAAACCTCC CGTCACCATT CATGGACTTA CCCGCCCTTA  TAAAAAACTT CAAGGACCAA GGGCTTGATA AAGAGGACTT GGTTGTGCTT TCGGGTGCAC ACACCCTAGG GTTTGCTCAG TGTTTTACCT TTAGGGATCG TATTCACAAT GAGACCAACA  TTCATCCAGC CTTTGCGAGC CACCTTCGGA CCATTTGTCC ACAAGTTGGG GCCAACTCAA GGCTCGCACC ACTTGACTCA ACACCTGGCT CGTTTGACGT GAAATACTTC ACCAATTTGG  TGAGTAAAAA GGGAATTTTG AGATCTGATC AAGCACTTTT TGATGGTGGC GTAACTAATG AGCTTGTTTC AAAATATATT CGGAACCAAA AAGAGTTTTG GGCGGATTTT GCAAAGTCTA  TGGTTAAAAT GGGTGATATA AAACCATTAA CAGGGAACAG AGGTCAAATT CGCAACATGT GTAGGAAAAC TAATTTCAAG AAATATTAAG AGTCCATCGA GTGGGTTAAT TTGTTTTATA  AGTTTGGGTG AGTATATATT GAGTGTTTGG GTATTTCAAT TCTTTTCGTA TGTCAATTTC TTAAAAACTC TAGTATTCTA TTCTTTCGTA TTTTGAATTA AAAACGTTTG TAATTTGATT 
GTTCTTTGTT ATGAATTGTT ATTAAGATTT GTTTTCTCAT ATATGTATCC CGGCTGAGAT TA 

Retrieve as FASTA