Entry information : HaPrx73 (HanXRQChr10g0286411)
Entry ID 13627
Creation 2016-05-02 (Christophe Dunand)
Last sequence changes 2016-05-02 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2017-11-23 (Catherine Mathe (Scipio))
Peroxidase information: HaPrx73 (HanXRQChr10g0286411)
Name (synonym) HaPrx73 (HanXRQChr10g0286411)
Class Class III peroxidase    [Orthogroup: Prx013]
Taxonomy Eukaryota Viridiplantae Streptophyta Asteraceae Helianthus
Organism Helianthus annuus (Sunflower)    [TaxId: 4232 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HaPrx73
start..stop
S start..stop
HaPrx132 568 0 30..321 33..324
HaPrx59 565 0 18..321 21..324
HaPrx[P]70 560 0 18..321 21..324
HaPrx71 556 0 1..318 4..321
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 46739498..46739710 213 N° 2 46740066..46740260 195 N° 3 46740483..46741040 558  
join(46739498..46739710,46740066..46740260,46740483..46741040)


exon

Literature and cross-references HaPrx73 (HanXRQChr10g0286411)
DNA ref. HanXRQ genome:   HanXRQChr10 (46739498..46741040)
Protein sequence: HaPrx73 (HanXRQChr10g0286411)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   321 (299)
PWM (Da):   %s   34822.55 (32388.3)  
PI (pH):   %s   5.73 (5.44) Peptide Signal:   %s   cut: 23 range:23-321
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MNTRNYISIFAFVLFSIATASSDSGLSPSYYDRVCPEALPTIKRVVEDALAQERRMGASILRLHFHDCFVKGCDASILLDQTSTIDSEKNAGPNANSARGFEVIDKIKDEVDKVCGRPVVSCADILTVAARDSVVALGGPSWKVKLGRRDSTTASRTAADANIPAPSIDLPALIKNFEDQGLDEEDLVVLSGAHTLGFARCRTFRPRIYSDTNIDPAFASHLRTICPQVGGDSTLAPLDPTPTSFDVKYFTDLVSKKGLLNSDQALFNGGETAELVSKYSMNHEEFLEDFAKSMIKMGDIKPLAGNRGEIRNNCRKVNSQY*

Retrieve as FASTA  
Remarks
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAACACCAGAAACTACATATCTATTTTTGCTTTTGTTCTTTTTTCTATTGCTACCGCATCTTCAGACTCGGGTTTGTCACCAAGTTATTACGATCGAGTGTGCCCTGAAGCTCTCCCA
ACCATCAAACGTGTGGTGGAGGATGCATTGGCACAAGAACGTCGCATGGGTGCTTCTATTTTACGTCTTCATTTTCATGATTGTTTTGTTAAG
GTAAGTAACTTATTCATACCAATTTAT
ACTTGAGATTCCACATTTGTTATTGATGTTGCTTGGCAGTTGATTGCAAAGTTATACTTTTGCCATGGAAACGCCTCAGTTATGAGCTAATAAACAAAACCTAGAAAACGAATTTAGAAT
TTTAAATTTATGATCTTTAAGAACTATACCAACAAGTCTTTCTATAATTATGATCCATTAGAAACTTTCGCACGTGACGTTGCAAAATGAAGTGTTATCTTGTATCAATGTAGCATTTAA
TCAAGTGGAAAGGGTTGGTGTTGTCGTTTTGAGTTTAATTTCTATTACAAGGAATGTGTTTTTTAAGTTTATTTTCTATTTCATGTAGGGATGCGATGCTTCCATTCTTTTGGACCAAAC
ATCAACAATAGATAGTGAGAAAAATGCAGGCCCCAATGCAAATTCAGCTCGAGGATTCGAGGTTATCGACAAAATCAAGGATGAGGTCGACAAAGTTTGTGGTCGCCCTGTGGTGTCTTG
TGCTGATATCTTAACTGTTGCTGCTCGTGATTCTGTAGTTGCG
GTAAGTAAAACATGTTAATCAAAACCTAGAATTTAAACTTGTCTAACATATGTACCTATGGTATAGTGTACTTATGT
AAAGGTGTTTGGTGTTTCTAATAGTTTCAACTTGGGGTAGACCATTGGGGTACCGTTGGCATGCATGTTTATGATGAAAATAAAAACTAAAAACATGAATGATGATGCATTTTATGACGC
TAAATGTTAATTTGTATGGATGTAGCTTGGTGGCCCATCATGGAAAGTCAAGCTCGGAAGAAGAGACTCAACCACGGCTAGCCGGACCGCAGCTGATGCTAACATCCCGGCACCGTCCAT
TGACTTACCCGCCCTAATAAAAAACTTTGAGGACCAAGGGCTCGATGAGGAGGACTTAGTTGTGCTTTCGGGTGCACACACCCTAGGGTTTGCACGGTGTCGAACCTTTAGGCCTCGTAT
TTACAGTGATACCAACATAGATCCAGCGTTTGCGAGCCATCTTCGGACTATTTGTCCACAAGTCGGGGGCGACTCAACTCTCGCACCACTTGACCCGACACCAACCTCGTTTGATGTAAA
ATACTTCACAGATTTGGTGAGTAAAAAGGGGCTTTTAAATTCTGATCAAGCACTGTTTAATGGTGGCGAAACTGCTGAGCTTGTTTCGAAATATAGTATGAACCACGAAGAGTTCTTAGA
AGATTTTGCAAAATCTATGATCAAAATGGGTGATATAAAGCCACTAGCGGGGAATAGAGGTGAAATTCGCAACAACTGCAGGAAAGTTAATTCACAATATTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAACACCAGAAACTACATATCTATTTTTGCTTTTGTTCTTTTTTCTATTGCTACCGCATCTTCAGACTCGGGTTTGTCACCAAGTTATTACGATCGAGTGTGCCCTGAAGCTCTCCCA
ACCATCAAACGTGTGGTGGAGGATGCATTGGCACAAGAACGTCGCATGGGTGCTTCTATTTTACGTCTTCATTTTCATGATTGTTTTGTTAAG
GGATGCGATGCTTCCATTCTTTTGGAC
CAAACATCAACAATAGATAGTGAGAAAAATGCAGGCCCCAATGCAAATTCAGCTCGAGGATTCGAGGTTATCGACAAAATCAAGGATGAGGTCGACAAAGTTTGTGGTCGCCCTGTGGTG
TCTTGTGCTGATATCTTAACTGTTGCTGCTCGTGATTCTGTAGTTGCG
CTTGGTGGCCCATCATGGAAAGTCAAGCTCGGAAGAAGAGACTCAACCACGGCTAGCCGGACCGCAGCTGAT
GCTAACATCCCGGCACCGTCCATTGACTTACCCGCCCTAATAAAAAACTTTGAGGACCAAGGGCTCGATGAGGAGGACTTAGTTGTGCTTTCGGGTGCACACACCCTAGGGTTTGCACGG
TGTCGAACCTTTAGGCCTCGTATTTACAGTGATACCAACATAGATCCAGCGTTTGCGAGCCATCTTCGGACTATTTGTCCACAAGTCGGGGGCGACTCAACTCTCGCACCACTTGACCCG
ACACCAACCTCGTTTGATGTAAAATACTTCACAGATTTGGTGAGTAAAAAGGGGCTTTTAAATTCTGATCAAGCACTGTTTAATGGTGGCGAAACTGCTGAGCTTGTTTCGAAATATAGT
ATGAACCACGAAGAGTTCTTAGAAGATTTTGCAAAATCTATGATCAAAATGGGTGATATAAAGCCACTAGCGGGGAATAGAGGTGAAATTCGCAACAACTGCAGGAAAGTTAATTCACAA
TATTAA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TTTGTACTAA AAACACTTTT TCTTGCCAAT TACGAAGAAG ATGAACACCA GAAACTACAT ATCTATTTTT GCTTTTGTTC TTTTTTCTAT TGCTACCGCA TCTTCAGACT CGGGTTTGTC  ACCAAGTTAT TACGATCGAG TGTGCCCTGA AGCTCTCCCA ACCATCAAAC GTGTGGTGGA GGATGCATTG GCACAAGAAC GTCGCATGGG TGCTTCTATT TTACGTCTTC ATTTTCATGA  TTGTTTTGTT AAGGGATGCG ATGCTTCCAT TCTTTTGGAC CAAACATCAA CAATAGATAG TGAGAAAAAT GCAGGCCCCA ATGCAAATTC AGCTCGAGGA TTCGAGGTTA TCGACAAAAT  CAAGGATGAG GTCGACAAAG TTTGTGGTCG CCCTGTGGTG TCTTGTGCTG ATATCTTAAC TGTTGCTGCT CGTGATTCTG TAGTTGCGCT TGGTGGCCCA TCATGGAAAG TCAAGCTCGG  AAGAAGAGAC TCAACCACGG CTAGCCGGAC CGCAGCTGAT GCTAACATCC CGGCACCGTC CATTGACTTA CCCGCCCTAA TAAAAAACTT TGAGGACCAA GGGCTCGATG AGGAGGACTT  AGTTGTGCTT TCGGGTGCAC ACACCCTAGG GTTTGCACGG TGTCGAACCT TTAGGCCTCG TATTTACAGT GATACCAACA TAGATCCAGC GTTTGCGAGC CATCTTCGGA CTATTTGTCC  ACAAGTCGGG GGCGACTCAA CTCTCGCACC ACTTGACCCG ACACCAACCT CGTTTGATGT AAAATACTTC ACAGATTTGG TGAGTAAAAA GGGGCTTTTA AATTCTGATC AAGCACTGTT  TAATGGTGGC GAAACTGCTG AGCTTGTTTC GAAATATAGT ATGAACCACG AAGAGTTCTT AGAAGATTTT GCAAAATCTA TGATCAAAAT GGGTGATATA AAGCCACTAG CGGGGAATAG 
AGGTGAAATT CGCAACAACT GCAGGAAAGT TAATTCACAA TATTAA 

Retrieve as FASTA