Entry information : HaPrx75 (HanXRQChr10g0294991)
Entry ID 13629
Creation 2016-05-02 (Christophe Dunand)
Last sequence changes 2016-05-02 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2017-11-23 (Catherine Mathe (Scipio))
Peroxidase information: HaPrx75 (HanXRQChr10g0294991)
Name (synonym) HaPrx75 (HanXRQChr10g0294991)
Class Class III peroxidase    [Orthogroup: Prx005]
Taxonomy Eukaryota Viridiplantae Streptophyta Asteraceae Helianthus
Organism Helianthus annuus (Sunflower)    [TaxId: 4232 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HaPrx75
start..stop
S start..stop
LvPrx45 479 2e-172 9..304 31..325
NnPrx21 454 1e-162 9..304 33..328
CclPrx104 453 3e-162 9..304 34..328
LvPrx21 447 2e-160 9..273 32..295
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 109826836..109826988 153 N° 2 109827439..109827627 189 N° 3 109827774..109827939 166 N° 4 109829847..109830253 407
join(109826836..109826988,109827439..109827627,109827774..109827939,109829847..1 09830253)


exon

Literature and cross-references HaPrx75 (HanXRQChr10g0294991)
DNA ref. HanXRQ genome:   HanXRQChr10 (109826836..109830253)
Protein sequence: HaPrx75 (HanXRQChr10g0294991)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   304
PWM (Da):   %s   33022.6  
PI (pH):   %s   6.77
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSMPMASSGFYENTCPKVEAIVQKIIAEKISLAPSLAAPLLRMHFHDCFVRGCDGSVLIDSTKNNQAEKDGFPNLSLRGFQIIDAAKTVVEAACPGVVSCADILALVARDAMYQIKGPYWPVPLGRRDGRVSIASESLTDLPSPFDNITRLKEHFTSKGLSVKDLVVLSGGHTIGTSHCLGVAVRLYNFTGKGDTDPSLDSDYVPYLKSKCKPTDTTTLIEMDPGSFRTFDENYYTNVLKRRGLFVSDAALLNDYETSAYVKLQAQSHGSTFLKDFQESMVKMGQIGVLTGSAGEIRQYCNAIN

Retrieve as FASTA  
Remarks partial sequence from genomic (part of PS is missing : MAYLKNLCSLFYHLLLLAFILTNNVNADGLK found with frame shift)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCAATGCCGATGGCCTCAAGTGGGTTCTATGAAAACACATGCCCTAAAGTTGAGGCTATTGTACAAAAGATAATAGCAGAAAAAATTTCGTTAGCTCCATCTCTTGCAGCTCCATTG
CTCCGAATGCACTTTCATGATTGTTTTGTTAGG
GTTAGTACATGTAGTATAAGCTTGTTTGTTACGTACACTTTTAACTTTTTAAGTTTCCTAACCCATACTTCACGTAATAGCATAACG
CATTACGTCTTCACATAAACTATGAAAAGGATCGGATATAGTCTATATCCGATCCTTTTCATAGTAACGAGTCTCGTCTTAGTTATATCTTATTTAAATCTACCATTTCGTCGGAAATTT
GTTTGAAAATGTTTCCCACAAATCATTTTTGTAAGAAATTTGTCGAAAATGGCAGTTTCGTACGCTTTTTTTTTTTTTTTGACATAATTTGGCATAGGAGTAGACTCACTTTTGTAGTAG
TGAGATGTAGAGAATTTTTTTGGGCATAGTACAATGTAAAGAGGGATTGTAATATTTTATAAATGGTATATCAGATTGCAACTTTATCACAAATTAAGTTGATAATCAGTTATTTATCTG
CAGGGCTGTGACGGTTCGGTCCTAATCGACTCTACAAAAAATAACCAAGCCGAGAAAGACGGATTTCCCAATCTTTCCCTTAGAGGATTTCAAATTATCGATGCAGCAAAAACTGTTGTA
GAAGCCGCATGCCCCGGTGTTGTCTCTTGCGCGGATATTTTAGCTTTAGTGGCTCGAGATGCCATGTATCAG
GTAATTACCATTACAAGAGAATGCGTAAATTAGACCTAAGTTTGCCCC
ACACCGTGGAGCCTTATGTACCGGGTTTGCCGTCTTTTTCTCTAAAATCTATCTTTTGGTATTTTTTAAAAAAGTATATATATTTTTTCTTTTTCTAGATTAAAGGCCCTTATTGGCCTG
TGCCACTGGGGAGAAGAGACGGAAGAGTATCAATAGCATCCGAGAGTTTGACTGATCTACCTTCTCCTTTTGATAACATTACTCGGCTCAAAGAACATTTCACCTCCAAGGGCTTGAGTG
TTAAAGATCTTGTTGTTCTTTCAG
GTATTTTGTCACCCAAAAAAATCAATAGAAAAATAATGTGGTCAATCACACAATTGTTTGTTCCTTGATGACAATATATGCGAATCAATCAATAAC
TACAGAATACTATATGGTAAAATACCGGTCAAATTTAACAAGATAAACATTAAATGTTCATTTTATAAAAATAAATTTATACTTTTTTTTTCTTCCGAGTGTACTTATGAGTACTAATCA
CTCGACCACGTGGACATCATTAGGACGTGACATGTGGCTTCTTTAGGCGAAAAAGCTGGTGCAAAACTAATATATATAGTCCGCGTGGAAGGCGGATTAGTGCTCTTGTACGCATGACAT
GCGACAAAGCATAGATTAGTTTTTGTAAAACAAAAGGTCAAGATTTATTCTGTCAACTTTGATTGACTCATTTTGGTGATTATTTCATGATAAAGGTATTATATACTATTTGAAAGGGTA
AAATACAATATCATTTAACGTACAAATTCAGGGGCGGAACCAGCGGGGGGTCAAGAGGGTCCGTTGACCCTCCGGTCACCGGAACTTTTTGAATTTTTATTTATAAATTTTGAGTTTTTA
AAGAACAAACTTAGGGATGGACCCCTAATTTGAACCAGTATAGAATATAAGCTTATGATGACCCCCTAACTAAATCGTTCTGGTTCCGTCATTGCGTACAATACGTATGAGATGAAATTA
TAACATGCGTGATTAGGTTTTTACCCATGCGTGATTTTTGATTTTGTACATGCGTGATGTATGGTTTTTCAACATGCGTGTTTAGGGTTTTGAGTTTTATAACATACGTAATTTCATCTC
GTACGCATCGTATATTAAGAAATATTGTATGTTAACCCACACCTATAAATTATATCTCCTAATTAATATATGATAAAATAAAAAGTGAATGAACAATATCATTCACTTTTCATTTTATAT
ATATTAATTCTTTATTTATTATGTGATTTTTTTTATATTGAGCAATACCTTATATTCATTTATTAGACTAACAGGTATGGGGTGAGGGTTTGGGCATGGTTTGGGTACAAATTCCCAAGT
CACCACCCCGGGTGGGTTTGGGTTTCGGTGTGGCCCCTTGAGCGGGAGTTTCAGCCCGGGCGTTGGGCATGCCTAGCGGTCCTCCGTGGCCGGCTCTCATTGGCTGGGTTGGCTAGGCCT
TAGCGGCTAGGTTTAAATTTTAAAAAATAACCGTTTTGCAAGTCACTATAAAACCCCCCAATCCCACCGCCTGTCCACATCGCTACCCCAACCCTTCACTCCACCTACCCGAACCCGCTA
CCCACACTTGATACCGGCACAACGCGATGAAGGGCCGCCAACCCGGTGAGACCCGTTGCTGGCCAGAAGCTTTCGCTAGCTACCGGCACAACGTGGGGAACGACCGTCACAATTTAAACT
CGTGCCAACACAAGTGGCGCGAGCTACGACCGAAGCTCTACCGTTTTAAAGCCTACTACGATAGCAGCCCGGGTGGTGATATAAGTCACGAAAACCGGGTGGCGGTGGCCAACATCGAGT
TCCAGGGCAAGGAGCGGAAGCCGTTTGACAAGCTCGCCCTATTCGAAATCTACCTAACGCTTTAGGCTTTTTTTTATTAACCGACCCAACACGTCACTCACCAACGGGGAGGCTCGAAGT
CCACTTTTACAGTGATTAAGTGTTGAAACAAGAGTTAGGGTCTACGTTCAGTCTTTGCAATAAGTGAAACAGTTAAATGAAGAGTTGCAGGATGATGTCGGTCGAAAACAACAATGCCTT
TCGCGCAACGCGCGTCATTGAAAAACACTAGTTATGGTTAAAAATATTATGATAAATTTAAACTAATTAAAAAGCACAACAATAAGAACCCGAATAACTTGGTTTAACATCTTGCCTATT
CTTTCATACAGGGGGACACACTATAGGGACTTCACACTGCCTTGGAGTAGCGGTTCGGTTGTACAATTTCACTGGCAAAGGTGACACCGATCCTTCACTAGACTCGGATTACGTACCTTA
CTTGAAGAGTAAATGTAAACCCACTGATACAACGACACTGATTGAGATGGATCCAGGGAGTTTTAGAACATTCGACGAGAATTACTACACTAATGTTTTGAAAAGGAGAGGCTTGTTTGT
ATCAGATGCTGCTCTTCTCAATGACTACGAAACAAGTGCTTATGTGAAGCTGCAAGCACAGTCTCATGGGTCTACATTCTTGAAGGATTTCCAGGAATCAATGGTTAAAATGGGCCAAAT
CGGAGTTCTGACTGGCAGTGCTGGTGAAATCAGGCAATATTGTAATGCAATTAACTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCAATGCCGATGGCCTCAAGTGGGTTCTATGAAAACACATGCCCTAAAGTTGAGGCTATTGTACAAAAGATAATAGCAGAAAAAATTTCGTTAGCTCCATCTCTTGCAGCTCCATTG
CTCCGAATGCACTTTCATGATTGTTTTGTTAGG
GGCTGTGACGGTTCGGTCCTAATCGACTCTACAAAAAATAACCAAGCCGAGAAAGACGGATTTCCCAATCTTTCCCTTAGAGGATTT
CAAATTATCGATGCAGCAAAAACTGTTGTAGAAGCCGCATGCCCCGGTGTTGTCTCTTGCGCGGATATTTTAGCTTTAGTGGCTCGAGATGCCATGTATCAG
ATTAAAGGCCCTTATTGG
CCTGTGCCACTGGGGAGAAGAGACGGAAGAGTATCAATAGCATCCGAGAGTTTGACTGATCTACCTTCTCCTTTTGATAACATTACTCGGCTCAAAGAACATTTCACCTCCAAGGGCTTG
AGTGTTAAAGATCTTGTTGTTCTTTCAG
GGGGACACACTATAGGGACTTCACACTGCCTTGGAGTAGCGGTTCGGTTGTACAATTTCACTGGCAAAGGTGACACCGATCCTTCACTAGAC
TCGGATTACGTACCTTACTTGAAGAGTAAATGTAAACCCACTGATACAACGACACTGATTGAGATGGATCCAGGGAGTTTTAGAACATTCGACGAGAATTACTACACTAATGTTTTGAAA
AGGAGAGGCTTGTTTGTATCAGATGCTGCTCTTCTCAATGACTACGAAACAAGTGCTTATGTGAAGCTGCAAGCACAGTCTCATGGGTCTACATTCTTGAAGGATTTCCAGGAATCAATG
GTTAAAATGGGCCAAATCGGAGTTCTGACTGGCAGTGCTGGTGAAATCAGGCAATATTGTAATGCAATTAACTAA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GGCATACCTT AAAAACCTTT GCTCCCTTTT TTACCATCTT CTACTTCTTG CTTTTATTTT GACCAATAAT GTCAATGCCG ATGGCCTCAA GTGGGTTCTA TGAAAACACA TGCCCTAAAG  TTGAGGCTAT TGTACAAAAG ATAATAGCAG AAAAAATTTC GTTAGCTCCA TCTCTTGCAG CTCCATTGCT CCGAATGCAC TTTCATGATT GTTTTGTTAG GGGCTGTGAC GGTTCGGTCC  TAATCGACTC TACAAAAAAT AACCAAGCCG AGAAAGACGG ATTTCCCAAT CTTTCCCTTA GAGGATTTCA AATTATCGAT GCAGCAAAAA CTGTTGTAGA AGCCGCATGC CCCGGTGTTG  TCTCTTGCGC GGATATTTTA GCTTTAGTGG CTCGAGATGC CATGTATCAG ATTAAAGGCC CTTATTGGCC TGTGCCACTG GGGAGAAGAG ACGGAAGAGT ATCAATAGCA TCCGAGAGTT  TGACTGATCT ACCTTCTCCT TTTGATAACA TTACTCGGCT CAAAGAACAT TTCACCTCCA AGGGCTTGAG TGTTAAAGAT CTTGTTGTTC TTTCAGGGGG ACACACTATA GGGACTTCAC  ACTGCCTTGG AGTAGCGGTT CGGTTGTACA ATTTCACTGG CAAAGGTGAC ACCGATCCTT CACTAGACTC GGATTACGTA CCTTACTTGA AGAGTAAATG TAAACCCACT GATACAACGA  CACTGATTGA GATGGATCCA GGGAGTTTTA GAACATTCGA CGAGAATTAC TACACTAATG TTTTGAAAAG GAGAGGCTTG TTTGTATCAG ATGCTGCTCT TCTCAATGAC TACGAAACAA  GTGCTTATGT GAAGCTGCAA GCACAGTCTC ATGGGTCTAC ATTCTTGAAG GATTTCCAGG AATCAATGGT TAAAATGGGC CAAATCGGAG TTCTGACTGG CAGTGCTGGT GAAATCAGGC  AATATTGTAA TGCAATTAAC TAAATATGTT GATTGGTTTC TTTTTATCTT AAGAGTGCAG CAAATGAAGC TGATGCGTGG TTTGATTAAA TAAAGAGACC CGCGAAAAGG GATCTTGCTC 
ACATATATGT GATGCTTGTA TATGGTATTG TTAAGTTGCG TAAATTTGTG AATATTTTAT ACACGGGCAG TATTAAATAA AAAGTTAGTG TCATATCAC 

Retrieve as FASTA