Entry information : HaPrx77 (HanXRQChr10g0296211)
Entry ID 13631
Creation 2016-05-02 (Christophe Dunand)
Last sequence changes 2016-05-02 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2017-11-23 (Catherine Mathe (Scipio))
Peroxidase information: HaPrx77 (HanXRQChr10g0296211)
Name (synonym) HaPrx77 (HanXRQChr10g0296211)
Class Class III peroxidase    [Orthogroup: Prx121]
Taxonomy Eukaryota Viridiplantae Streptophyta Asteraceae Helianthus
Organism Helianthus annuus (Sunflower)    [TaxId: 4232 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HaPrx77
start..stop
S start..stop
HaPrx21 753 0 16..391 1..376
HaPrx[P]76 629 0 58..391 1..334
HaPrx13 556 0 93..391 36..331
HaPrx20 551 0 58..391 1..330
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 117636454..117637047 594 N° 2 117636178..117636340 163 N° 3 117635664..117636082 419  
complement(join(117635664..117636082,117636178..117636340,117636454..117637047))


exon

Literature and cross-references HaPrx77 (HanXRQChr10g0296211)
DNA ref. HanXRQ genome:   HanXRQChr10 (117637047..117635664)
Protein sequence: HaPrx77 (HanXRQChr10g0296211)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   391
PWM (Da):   %s   42219.58  
PI (pH):   %s   8.97
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MYEVYLSPCFLAPPYMVDFQSPTKTIYTDPPCNVSTSTSHLRNTLLNLKDKSLLLLLMEISSLSKTVALLVLLLATLTTLSLGQGNRGSGRGTRLGYYRSSCPRAESIVQSAVRSAVQANPTIAPGLLRMFFHDCFVNGCDASILIDGPTTEKTAGPNSLLRGFEVIDAAKSQLETACPGVVSCADIVALAARDSVVLTGGRSWQVRLGRRDGLVSQASDTANLPAFNDPISVQIRKFADKGLNTQDLVTLVGGHTIGTAACALFSYRLYNFNNTNGPDPDINPAFLPQLRALCPNGGDALRRVALDKGSDNSFGNSFYENLRNGRGVIESDAKLWSDRRTQRFVQRYLGERGQTGSRFNAEFGRAMVKMGNIEVKTGTQGEIRRVCTATN

Retrieve as FASTA  
Remarks
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTATGAAGTTTATCTTTCTCCTTGCTTCCTTGCACCTCCATATATGGTTGACTTTCAATCTCCCACAAAGACTATATATACCGACCCTCCATGCAATGTCTCAACATCAACATCTCAT
TTACGAAATACATTACTTAACCTCAAAGACAAATCCTTGTTATTGTTACTAATGGAGATTTCCTCCTTAAGCAAAACGGTTGCTTTGTTGGTTCTTCTGTTAGCCACTCTCACAACCTTG
TCACTAGGTCAAGGCAACCGCGGTAGTGGCAGAGGCACCCGTCTTGGTTATTACAGGTCGTCCTGCCCTAGGGCCGAATCCATAGTTCAGTCTGCGGTTCGGTCTGCTGTCCAAGCCAAC
CCAACAATCGCACCTGGTTTACTAAGGATGTTCTTCCATGACTGCTTTGTCAATGGTTGTGATGCATCTATACTAATTGACGGACCCACAACTGAGAAGACAGCAGGCCCAAACTCTCTC
TTGAGAGGCTTTGAAGTTATTGATGCTGCAAAGTCCCAGCTCGAAACAGCCTGCCCAGGAGTGGTCTCATGTGCGGATATCGTTGCTCTTGCTGCACGTGATTCTGTGGTCTTG
GTAAGT
AGATATTTCCTTAACAGTTAACCCTAGCTTCTCATGCTGTTTGTACATTAGAAAGTTATAGTTATATATGCTTATTGCTTAATCATTTTTTTGATATATTATTGCAGACCGGTGGACGTA
GTTGGCAGGTACGATTAGGACGTAGAGATGGATTAGTTTCACAAGCATCGGATACCGCAAACTTGCCTGCCTTTAATGATCCTATTAGTGTCCAAATCCGAAAGTTTGCTGACAAAGGCC
TCAACACCCAAGATCTTGTTACTCTTGTCG
GTAAGTATAGCAAAAAAATGTTCAACAACTACTGCACATATAGAATGTTATGGCTACAAAAATAATTAAACATTGTGATTTATTTTTATT
TAAAGGTGGACACACTATTGGAACAGCAGCATGTGCATTATTCAGCTACAGGTTATACAACTTCAACAATACCAATGGACCCGACCCAGATATAAACCCAGCATTCCTACCACAGCTCCG
AGCACTTTGCCCCAATGGTGGCGATGCATTAAGACGTGTGGCGCTTGATAAAGGTAGCGATAATAGCTTCGGCAATTCATTCTATGAAAACTTGAGGAATGGAAGGGGAGTTATTGAATC
CGATGCAAAGCTATGGAGTGACCGCAGGACTCAGAGGTTTGTACAAAGGTATTTAGGGGAAAGGGGGCAAACGGGATCGAGATTTAACGCAGAGTTTGGAAGAGCAATGGTGAAGATGGG
TAATATTGAGGTGAAAACAGGGACACAAGGTGAAATCCGTAGAGTGTGTACTGCAACCAATTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTATGAAGTTTATCTTTCTCCTTGCTTCCTTGCACCTCCATATATGGTTGACTTTCAATCTCCCACAAAGACTATATATACCGACCCTCCATGCAATGTCTCAACATCAACATCTCAT
TTACGAAATACATTACTTAACCTCAAAGACAAATCCTTGTTATTGTTACTAATGGAGATTTCCTCCTTAAGCAAAACGGTTGCTTTGTTGGTTCTTCTGTTAGCCACTCTCACAACCTTG
TCACTAGGTCAAGGCAACCGCGGTAGTGGCAGAGGCACCCGTCTTGGTTATTACAGGTCGTCCTGCCCTAGGGCCGAATCCATAGTTCAGTCTGCGGTTCGGTCTGCTGTCCAAGCCAAC
CCAACAATCGCACCTGGTTTACTAAGGATGTTCTTCCATGACTGCTTTGTCAATGGTTGTGATGCATCTATACTAATTGACGGACCCACAACTGAGAAGACAGCAGGCCCAAACTCTCTC
TTGAGAGGCTTTGAAGTTATTGATGCTGCAAAGTCCCAGCTCGAAACAGCCTGCCCAGGAGTGGTCTCATGTGCGGATATCGTTGCTCTTGCTGCACGTGATTCTGTGGTCTTG
ACCGGT
GGACGTAGTTGGCAGGTACGATTAGGACGTAGAGATGGATTAGTTTCACAAGCATCGGATACCGCAAACTTGCCTGCCTTTAATGATCCTATTAGTGTCCAAATCCGAAAGTTTGCTGAC
AAAGGCCTCAACACCCAAGATCTTGTTACTCTTGTCG
GTGGACACACTATTGGAACAGCAGCATGTGCATTATTCAGCTACAGGTTATACAACTTCAACAATACCAATGGACCCGACCCA
GATATAAACCCAGCATTCCTACCACAGCTCCGAGCACTTTGCCCCAATGGTGGCGATGCATTAAGACGTGTGGCGCTTGATAAAGGTAGCGATAATAGCTTCGGCAATTCATTCTATGAA
AACTTGAGGAATGGAAGGGGAGTTATTGAATCCGATGCAAAGCTATGGAGTGACCGCAGGACTCAGAGGTTTGTACAAAGGTATTTAGGGGAAAGGGGGCAAACGGGATCGAGATTTAAC
GCAGAGTTTGGAAGAGCAATGGTGAAGATGGGTAATATTGAGGTGAAAACAGGGACACAAGGTGAAATCCGTAGAGTGTGTACTGCAACCAATTGA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTATGAAG TTTATCTTTC TCCTTGCTTC CTTGCACCTC CATATATGGT TGACTTTCAA TCTCCCACAA AGACTATATA TACCGACCCT CCATGCAATG TCTCAACATC AACATCTCAT  TTACGAAATA CATTACTTAA CCTCAAAGAC AAATCCTTGT TATTGTTACT AATGGAGATT TCCTCCTTAA GCAAAACGGT TGCTTTGTTG GTTCTTCTGT TAGCCACTCT CACAACCTTG  TCACTAGGTC AAGGCAACCG CGGTAGTGGC AGAGGCACCC GTCTTGGTTA TTACAGGTCG TCCTGCCCTA GGGCCGAATC CATAGTTCAG TCTGCGGTTC GGTCTGCTGT CCAAGCCAAC  CCAACAATCG CACCTGGTTT ACTAAGGATG TTCTTCCATG ACTGCTTTGT CAATGGTTGT GATGCATCTA TACTAATTGA CGGACCCACA ACTGAGAAGA CAGCAGGCCC AAACTCTCTC  TTGAGAGGCT TTGAAGTTAT TGATGCTGCA AAGTCCCAGC TCGAAACAGC CTGCCCAGGA GTGGTCTCAT GTGCGGATAT CGTTGCTCTT GCTGCACGTG ATTCTGTGGT CTTGACCGGT  GGACGTAGTT GGCAGGTACG ATTAGGACGT AGAGATGGAT TAGTTTCACA AGCATCGGAT ACCGCAAACT TGCCTGCCTT TAATGATCCT ATTAGTGTCC AAATCCGAAA GTTTGCTGAC  AAAGGCCTCA ACACCCAAGA TCTTGTTACT CTTGTCGGTG GACACACTAT TGGAACAGCA GCATGTGCAT TATTCAGCTA CAGGTTATAC AACTTCAACA ATACCAATGG ACCCGACCCA  GATATAAACC CAGCATTCCT ACCACAGCTC CGAGCACTTT GCCCCAATGG TGGCGATGCA TTAAGACGTG TGGCGCTTGA TAAAGGTAGC GATAATAGCT TCGGCAATTC ATTCTATGAA  AACTTGAGGA ATGGAAGGGG AGTTATTGAA TCCGATGCAA AGCTATGGAG TGACCGCAGG ACTCAGAGGT TTGTACAAAG GTATTTAGGG GAAAGGGGGC AAACGGGATC GAGATTTAAC 
GCAGAGTTTG GAAGAGCAAT GGTGAAGATG GGTAATATTG AGGTGAAAAC AGGGACACAA GGTGAAATCC GTAGAGTGTG TACTGCAACC AATTGA 

Retrieve as FASTA