Entry information : HaPrx78 (HanXRQChr10g0308721)
Entry ID 13632
Creation 2016-05-02 (Christophe Dunand)
Last sequence changes 2016-05-02 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2017-11-23 (Catherine Mathe (Scipio))
Peroxidase information: HaPrx78 (HanXRQChr10g0308721)
Name (synonym) HaPrx78 (HanXRQChr10g0308721)
Class Class III peroxidase    [Orthogroup: Prx025]
Taxonomy Eukaryota Viridiplantae Streptophyta Asteraceae Helianthus
Organism Helianthus annuus (Sunflower)    [TaxId: 4232 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HaPrx78
start..stop
S start..stop
LsPrx26 589 0 1..318 1..318
HaPrx94 583 0 1..318 1..318
HaPrx95 581 0 1..318 15..334
HargPrx04 571 0 1..313 1..315
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 206386519..206386719 201 N° 2 206386222..206386413 192 N° 3 206385399..206385564 166 N° 4 206384853..206385250 398
complement(join(206384853..206385250,206385399..206385564,206386222..206386413,2 06386519..206386719))


exon

Literature and cross-references HaPrx78 (HanXRQChr10g0308721)
DNA ref. HanXRQ genome:   HanXRQChr10 (206386719..206384853)
Protein sequence: HaPrx78 (HanXRQChr10g0308721)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   318 (298)
PWM (Da):   %s   34825.77 (32521.5)  
PI (pH):   %s   9.28 (9.10) Peptide Signal:   %s   cut: 21 range:21-318
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MKKQIICFLFLSLFIASSYAQLKQNFYQNTCPNVESIVKAAVTKKFQQTFVTVPGTLRLFFHDCFVRGCDASVLLANANAEKDHPDDISLAGDGFDTVIKAKAALDSNPSCRNKVSCADILALATRDVIVLSGGPSYSVELGRRDGRISTKASVQNNLPHPDFKLDQLNTMFAKHGLSQTDMIALSGAHTLGFSHCGKFSSRIYSKNGIDPTLNRQYALQLRQMCPINVDPRIAINMDPTTPRTFDNAYYKNLQQGKGLFVSDQILFTDNRSKPTVNLFASSNTAFNQAFVTAITKLGRVGVLTGNQGEIRRDCTLAN

Retrieve as FASTA  
Remarks
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAGAAGCAAATAATATGTTTCTTGTTCCTCTCTTTGTTTATTGCTTCATCTTATGCTCAACTCAAACAAAATTTCTATCAAAATACTTGTCCAAATGTCGAATCCATCGTCAAAGCA
GCCGTCACAAAAAAATTTCAGCAGACTTTCGTGACGGTTCCAGGCACTCTTCGCCTCTTCTTCCATGATTGTTTTGTTCGG
GTGACTCCATTTCGAATATATACATTCACTTTTACATTT
GTTTGTCTAGTAAAATATTGTTGTATACTAATTATATATGTTATGGTTGTATATATATATACATAGGGATGTGATGCTTCGGTTCTTCTTGCTAATGCGAACGCCGAGAAGGACCATCCT
GACGACATATCACTCGCTGGAGATGGATTTGACACCGTCATCAAAGCGAAAGCCGCTCTAGATAGCAATCCAAGTTGCCGGAACAAAGTTTCTTGTGCAGATATATTGGCTCTTGCCACT
AGAGATGTCATTGTTTTG
GTACGTGCAATCACATTTTTTATTTTATAGTTTTTTGATCACAAAAAATAAAAATAAAGGAGCGAATTCACATCATTAATCCGTGGGTAAGGTGTTTACCGA
CAAGAAACAACCGTTAGAAATTTAAAAACGAGTAATTTCATTTGCAACAGATTACTGATAGACATTACCGAGGGATCACCCTTGTCAACCTCTTCTTCAGGGGCGGACCTTATAAGTTAG
AGCTTGGGTGGGCGTGCGCACCCCTAAAAACAATTTTTTGGTGTATTTTATAGGCTACAATCCCGATCGTACCACTTGAAATTTTGGTTAAACCCTTCTTCAGTAATTACTTATGAATGG
GTTACCGACTGAAAACTTTATATTACATTTTCAAAATTTTATTTTGGAATTTGCTAGGTTCGGTTGGTAGTTCGTTGGATCGGTACCATAATACTTGTTTGTGTTGTAATGAATAAATAT
TTATTTAGAGTCGTGTTATGAATTTACATCGATATAGTTGGTAATGAATGTGCCTGTAAAAAAATCAAATATACACCCTTATTGGGTCTCATGAAAGTGTGATACATATAAAGAAATACA
AGAGTTTTTTGTATATATTTTATAACATAGTTTTGAGTATACATTTACTTATTTATTTGCTTAAAAAATAAACAGTCAGGTGGACCATCATACAGTGTAGAGTTGGGAAGAAGAGATGGA
AGAATTTCTACAAAGGCAAGTGTGCAGAATAATCTTCCACATCCAGATTTTAAACTGGACCAACTTAATACCATGTTTGCAAAGCATGGGTTATCTCAAACCGATATGATTGCACTTTCA
G
GTAAATACTTTACATCAAGTTCGGTTTATATAGAATATATTAGTTAGGGTTTACTAGACAGAAACAAAAGTTCGGTTTATATTTAGTTAGGGTTTACTAGACAGAAACAAGTTTGTATT
TAAATTATGTTAAACGGTTGCATGTATAGGTGCACATACGCTTGGATTCTCTCACTGTGGCAAATTCTCGTCGCGTATATATTCGAAGAATGGAATAGACCCAACCCTAAACCGCCAATA
TGCCCTTCAGCTAAGGCAGATGTGCCCCATAAATGTTGACCCCCGTATCGCGATCAACATGGACCCCACCACCCCTCGAACTTTCGACAATGCATATTATAAGAACCTTCAACAAGGAAA
GGGTTTGTTTGTCTCTGACCAAATCTTGTTTACCGACAACCGGTCAAAGCCAACGGTCAACCTATTTGCGTCTAGCAACACCGCCTTTAACCAAGCTTTCGTGACCGCCATTACCAAGCT
TGGGCGAGTTGGGGTCTTGACCGGTAACCAGGGTGAGATCAGACGTGATTGCACACTCGCAAACTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAGAAGCAAATAATATGTTTCTTGTTCCTCTCTTTGTTTATTGCTTCATCTTATGCTCAACTCAAACAAAATTTCTATCAAAATACTTGTCCAAATGTCGAATCCATCGTCAAAGCA
GCCGTCACAAAAAAATTTCAGCAGACTTTCGTGACGGTTCCAGGCACTCTTCGCCTCTTCTTCCATGATTGTTTTGTTCGG
GGATGTGATGCTTCGGTTCTTCTTGCTAATGCGAACGCC
GAGAAGGACCATCCTGACGACATATCACTCGCTGGAGATGGATTTGACACCGTCATCAAAGCGAAAGCCGCTCTAGATAGCAATCCAAGTTGCCGGAACAAAGTTTCTTGTGCAGATATA
TTGGCTCTTGCCACTAGAGATGTCATTGTTTTG
TCAGGTGGACCATCATACAGTGTAGAGTTGGGAAGAAGAGATGGAAGAATTTCTACAAAGGCAAGTGTGCAGAATAATCTTCCACAT
CCAGATTTTAAACTGGACCAACTTAATACCATGTTTGCAAAGCATGGGTTATCTCAAACCGATATGATTGCACTTTCAG
GTGCACATACGCTTGGATTCTCTCACTGTGGCAAATTCTCG
TCGCGTATATATTCGAAGAATGGAATAGACCCAACCCTAAACCGCCAATATGCCCTTCAGCTAAGGCAGATGTGCCCCATAAATGTTGACCCCCGTATCGCGATCAACATGGACCCCACC
ACCCCTCGAACTTTCGACAATGCATATTATAAGAACCTTCAACAAGGAAAGGGTTTGTTTGTCTCTGACCAAATCTTGTTTACCGACAACCGGTCAAAGCCAACGGTCAACCTATTTGCG
TCTAGCAACACCGCCTTTAACCAAGCTTTCGTGACCGCCATTACCAAGCTTGGGCGAGTTGGGGTCTTGACCGGTAACCAGGGTGAGATCAGACGTGATTGCACACTCGCAAACTGA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCACATAC TCATTTGTAT AAGTCAAGGA CCCTGTTGTA ACAATAATAT ATATATAGGT ATATCTATAT ATAACATCTT CATCACCCTC ATTCTTATAA CAAAGAAAAC AAGATAGCAA  GATGAAGAAG CAAATAATAT GTTTCTTGTT CCTCTCTTTG TTTATTGCTT CATCTTATGC TCAACTCAAA CAAAATTTCT ATCAAAATAC TTGTCCAAAT GTCGAATCCA TCGTCAAAGC  AGCCGTCACA AAAAAATTTC AGCAGACTTT CGTGACGGTT CCAGGCACTC TTCGCCTCTT CTTCCATGAT TGTTTTGTTC GGGGATGTGA TGCTTCGGTT CTTCTTGCTA ATGCGAACGC  CGAGAAGGAC CATCCTGACG ACATATCACT CGCTGGAGAT GGATTTGACA CCGTCATCAA AGCGAAAGCC GCTCTAGATA GCAATCCAAG TTGCCGGAAC AAAGTTTCTT GTGCAGATAT  ATTGGCTCTT GCCACTAGAG ATGTCATTGT TTTGTCAGGT GGACCATCAT ACAGTGTAGA GTTGGGAAGA AGAGATGGAA GAATTTCTAC AAAGGCAAGT GTGCAGAATA ATCTTCCACA  TCCAGATTTT AAACTGGACC AACTTAATAC CATGTTTGCA AAGCATGGGT TATCTCAAAC CGATATGATT GCACTTTCAG GTGCACATAC GCTTGGATTC TCTCACTGTG GCAAATTCTC  GTCGCGTATA TATTCGAAGA ATGGAATAGA CCCAACCCTA AACCGCCAAT ATGCCCTTCA GCTAAGGCAG ATGTGCCCCA TAAATGTTGA CCCCCGTATC GCGATCAACA TGGACCCCAC  CACCCCTCGA ACTTTCGACA ATGCATATTA TAAGAACCTT CAACAAGGAA AGGGTTTGTT TGTCTCTGAC CAAATCTTGT TTACCGACAA CCGGTCAAAG CCAACGGTCA ACCTATTTGC  GTCTAGCAAC ACCGCCTTTA ACCAAGCTTT CGTGACCGCC ATTACCAAGC TTGGGCGAGT TGGGGTCTTG ACCGGTAACC AGGGTGAGAT CAGACGTGAT TGCACACTCG CAAACTGAAA  GAACGAAACG ATGAAACTCG TCTCGTATAA TTATTTATTC AATTCCAAAT TGTAAATTTG ATTTTTGAAT AAGTAGCTAA AACTGTTCAC ATGCATGTTA ATCATGTTGG TTTGGTTTTG 
CTCGTATCTT ACTTGTTCTT GATGTTGAAA TGACTAAATG ATCATTTAAG TTATCCGTGA ATAATATTTG TTTGTTA 

Retrieve as FASTA