Entry information : HaPrx80 (HanXRQChr10g0314801)
Entry ID 13634
Creation 2016-05-02 (Christophe Dunand)
Last sequence changes 2016-05-02 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2017-11-23 (Catherine Mathe (Scipio))
Peroxidase information: HaPrx80 (HanXRQChr10g0314801)
Name (synonym) HaPrx80 (HanXRQChr10g0314801)
Class Class III peroxidase    [Orthogroup: Prx019]
Taxonomy Eukaryota Viridiplantae Streptophyta Asteraceae Helianthus
Organism Helianthus annuus (Sunflower)    [TaxId: 4232 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HaPrx80
start..stop
S start..stop
LsaPrx06 595 0 25..365 1..337
LvPrx06 541 0 25..330 1..302
CsPrx06 529 0 30..346 1..316
CclPrx39 523 0 30..346 1..316
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 230040600..230040884 285 N° 2 230039956..230040147 192 N° 3 230037826..230038449 624  
complement(join(230037826..230038449,230039956..230040147,230040600..230040884))


exon

Literature and cross-references HaPrx80 (HanXRQChr10g0314801)
DNA ref. HanXRQ genome:   HanXRQChr10 (230040884..230037826)
Protein sequence: HaPrx80 (HanXRQChr10g0314801)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   366
PWM (Da):   %s   40678.54 Transmb domain:   %s   i21-43o
PI (pH):   %s   6.77
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MHPLYNKVKNTLHKTLPSKPFLGIMCLLLLPFIIFLHLLPATIPSAAPPLHPGYYANSCPNAELIVRNVMKKAMIREPRSGASVMRFQFHDCFVNGCDGSMLLDDTPTMLGEKLSLSNIDSLRSYEVVDEIKEALETACPRTVSCADIIIMASRDAVALSGGPDWEVKLGRKDSLTASQEDADAIMPSPRANATTLIDLFAKFDLSVKDLVALSGSHSIGNGRCFSIVFRLYNQSGTGRPDPSIEPKFRQKLDKLCPLGGDGNVTGDLDFTPRIFDNQYFKDLVNGRGFLNSDETLYTYWKTREYVKRYSEDQDEFFRDFVEGMIKMGDLQSGRPGEIRKNCRVVNGGPPMDLVVDGYKDRRILSY*

Retrieve as FASTA  
Remarks
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCATCCTCTTTATAATAAAGTTAAAAACACACTACACAAAACCCTCCCTTCAAAACCTTTTCTGGGAATAATGTGTCTCCTCCTCCTCCCCTTCATCATCTTCCTCCACCTCCTTCCG
GCCACCATCCCTTCCGCAGCACCACCGCTCCACCCGGGTTACTACGCCAATTCTTGCCCAAATGCCGAACTCATCGTCCGAAACGTCATGAAAAAGGCCATGATCCGAGAACCCCGAAGC
GGAGCTTCCGTCATGCGATTTCAATTCCATGATTGTTTCGTTAAC
GTAAGCATCTTCCTCTGTTTTTTTTCTCTTATTTTTTTTTAATCTCAAATCAAATCAAATTAGCCGTAAATTTAA
CTTTTTTGATGCTACCGTATTATACCGGTCCTGACCGAACTCCATCGGTAACGGTACCAGTATTCGTTCTAAACAATTTCGGCTTATGTATTTTTCCGTATGTTCAATGATACGAGTCCT
AACCCAACACCAACTGTAACAGTACCATATTCTTTTATAAAAAAAATCGGTATCAGTATTTTTCAGGGTCAGTACTTTTTTTTTCAACGAAACCAGTACTGTACCATACCGGTCCCAAAT
GAACATCAACTATACTGATACCGGTATTTATATCTTCAATAATATCCTACCGGCCAAGGGTACAAAGTGGTGAGCTAAATTTCAGTTTCGTACGGTTTTGTCTAGTGACACTGATTTTGG
GAATGAATGATTGACAGGGATGTGATGGATCGATGTTGTTGGATGATACTCCAACGATGCTCGGAGAGAAGCTATCTTTGTCGAACATAGATTCGTTGCGATCGTACGAGGTTGTCGATG
AAATCAAGGAAGCACTTGAGACGGCCTGCCCCCGGACTGTTTCTTGTGCGGATATCATTATCATGGCCTCTAGGGATGCCGTCGCTCTG
GTATTTAATTTAATTCTTTTACCTAACAATA
TCTTATTATTTCAATATTATTTAATGAAAGTCTTGAATTATTCATAGAATAATAGATGTTTCCAAATTCCAAACATCGGTTCAAAAATCGAGGGTTATCAACGTATCAACTAGGGTCTAG
TCTCTGCAGGATTCGTTTCGTTGGCGTTAAAAAAAAAGTCTAGTGTCTGCTTTTATTATTATTTTTTTATAAACCACTTACACCATCCGTAGACCGTAGTGGGTAACAATTTAAGCGTTT
TTTATCCCATCACACCCGAACACTTCGGCGCACCGCCCGCGTTTCTTTTTTTCAACTTTTTTGTTGGGCGTTTTGATTAAAACGTCAAATTGTTCAAAAAATTCAAACTTTGACCAATAA
TAAATTTCCAACTCATTTATTTATTTTATTTTTCTAAAAAAAATAATAATTGGGTAATCACTGTTGAGGCATTATAGGGCACTATACTACTACATCCCATTTTAACAAATGCTCCTTTGT
TGACTAGGCGGCCACATGTCGTTTCATGCCTAAAGTTGGGGCATTTTTTCACTCTCCACTACACATGATCTTGTAAAAGTGATTTAGGAAGCAGTAGTATTTAGGTGTAAAGTTGATCTT
CAAAAGCTTTTGTTTTTGTAGTTCAGAATTTTTAGGTGTAAAGTTGATGTTCAAAAGTTTATGTTTTTGCAAATTCAGAATTAATTCAAATAAGAAAACATAATAATTGAAGAATCGTAT
GTTTATTTTAAATGTGACACATAACCAATTCTAGATATGATGGATGTGTGTGACATAATTTACTCTATCTCTTTCTTAATATGTATGATTACTAATACATATAAATGTTTTATACTGTTG
TTATGTTATTCTATTAAAAATTGGTTATGTTTTACCAATACAAGTTAAGTGTTGAGATTTGAAGGAAAATTCTATTATACCAGAATTACAGAGTTATCGTTCCTTATATATATAAATTCT
ATTATACTATGTGATATTCTATGCTCATAAACAAATAAAGTGATAGTTATAACAAAGCGGATCACAAGAGATACTATTTTGGTTCTTTTTATAACTAGCGCTATTTAGGAACGTCGTGGC
TTGTTCAAAAAAACTTGCTCATACCCAGCTAATTTACAAACAAGCCGGGCCAAGCTGGATTTATTTGTAAACGAGCCAAACTTGAGCCAAGATAAGCTCGTTCGTTGGATCGTTCATTAC
GTTTATAAGTTATAACTCCATAACAAATATAAATAAGCTTACATAAAATAGTCCATGAATCCACTTAAGACACCCTAGTTTTTATTTTAACATTACTGTTTTGCATATGATATTAAATTA
AATAATTAGTTATTAATTTTAACTAAAGTTGGCCCGATCTTTTTACAAGCCGAGCCTTGCTCGATTGTTTTACAAGCCGAGTCCAAGGTCAACGTTTCGGTTTATAAACTATATTATTGA
TTCAACATTTTGTTTTTCGGTTTTGTGTCAACTAGAGTGGAGGTCCGGATTGGGAAGTGAAGCTGGGAAGAAAAGATAGCCTAACCGCAAGTCAAGAGGATGCCGATGCCATAATGCCTA
GTCCGCGAGCGAACGCAACCACCCTCATCGATCTCTTTGCCAAATTTGACCTCTCGGTCAAAGATTTAGTAGCCCTTTCGGGCTCACACTCGATTGGTAACGGGCGTTGTTTCTCCATTG
TGTTTAGGCTCTACAATCAATCAGGCACAGGCCGCCCAGACCCCTCCATCGAGCCAAAGTTTAGACAAAAGTTAGACAAACTTTGCCCACTTGGTGGTGATGGGAATGTCACAGGCGATT
TGGACTTTACGCCTCGCATCTTCGACAATCAATATTTCAAAGATTTGGTAAATGGAAGAGGGTTTTTGAATTCTGATGAAACATTGTACACTTATTGGAAAACAAGAGAGTATGTTAAAA
GGTATAGTGAGGATCAAGATGAGTTCTTTAGGGACTTTGTTGAGGGGATGATTAAGATGGGCGACTTACAATCGGGGCGGCCCGGGGAGATTCGGAAGAATTGTAGGGTGGTCAACGGTG
GTCCACCGATGGACTTGGTGGTGGATGGATATAAAGATAGGAGGATATTGAGTTATTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCATCCTCTTTATAATAAAGTTAAAAACACACTACACAAAACCCTCCCTTCAAAACCTTTTCTGGGAATAATGTGTCTCCTCCTCCTCCCCTTCATCATCTTCCTCCACCTCCTTCCG
GCCACCATCCCTTCCGCAGCACCACCGCTCCACCCGGGTTACTACGCCAATTCTTGCCCAAATGCCGAACTCATCGTCCGAAACGTCATGAAAAAGGCCATGATCCGAGAACCCCGAAGC
GGAGCTTCCGTCATGCGATTTCAATTCCATGATTGTTTCGTTAAC
GGATGTGATGGATCGATGTTGTTGGATGATACTCCAACGATGCTCGGAGAGAAGCTATCTTTGTCGAACATAGAT
TCGTTGCGATCGTACGAGGTTGTCGATGAAATCAAGGAAGCACTTGAGACGGCCTGCCCCCGGACTGTTTCTTGTGCGGATATCATTATCATGGCCTCTAGGGATGCCGTCGCTCTG
AGT
GGAGGTCCGGATTGGGAAGTGAAGCTGGGAAGAAAAGATAGCCTAACCGCAAGTCAAGAGGATGCCGATGCCATAATGCCTAGTCCGCGAGCGAACGCAACCACCCTCATCGATCTCTTT
GCCAAATTTGACCTCTCGGTCAAAGATTTAGTAGCCCTTTCGGGCTCACACTCGATTGGTAACGGGCGTTGTTTCTCCATTGTGTTTAGGCTCTACAATCAATCAGGCACAGGCCGCCCA
GACCCCTCCATCGAGCCAAAGTTTAGACAAAAGTTAGACAAACTTTGCCCACTTGGTGGTGATGGGAATGTCACAGGCGATTTGGACTTTACGCCTCGCATCTTCGACAATCAATATTTC
AAAGATTTGGTAAATGGAAGAGGGTTTTTGAATTCTGATGAAACATTGTACACTTATTGGAAAACAAGAGAGTATGTTAAAAGGTATAGTGAGGATCAAGATGAGTTCTTTAGGGACTTT
GTTGAGGGGATGATTAAGATGGGCGACTTACAATCGGGGCGGCCCGGGGAGATTCGGAAGAATTGTAGGGTGGTCAACGGTGGTCCACCGATGGACTTGGTGGTGGATGGATATAAAGAT
AGGAGGATATTGAGTTATTAG

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
AAACATCAAT CAAAGTTGAT GTACACATCA CATATTTGAT ATTTACATTG GTTGTGGTTC AAACCTTATC CCCCACTTTC ACCCATACAA TGCATCCTCT TTATAATAAA GTTAAAAACA  CACTACACAA AACCCTCCCT TCAAAACCTT TTCTGGGAAT AATGTGTCTC CTCCTCCTCC CCTTCATCAT CTTCCTCCAC CTCCTTCCGG CCACCATCCC TTCCGCAGCA CCACCGCTCC  ACCCGGGTTA CTACGCCAAT TCTTGCCCAA ATGCCGAACT CATCGTCCGA AACGTCATGA AAAAGGCCAT GATCCGAGAA CCCCGAAGCG GAGCTTCCGT CATGCGATTT CAATTCCATG  ATTGTTTCGT TAACGGATGT GATGGATCGA TGTTGTTGGA TGATACTCCA ACGATGCTCG GAGAGAAGCT ATCTTTGTCG AACATAGATT CGTTGCGATC GTACGAGGTT GTCGATGAAA  TCAAGGAAGC ACTTGAGACG GCCTGCCCCC GGACTGTTTC TTGTGCGGAT ATCATTATCA TGGCCTCTAG GGATGCCGTC GCTCTGAGTG GAGGTCCGGA TTGGGAAGTG AAGCTGGGAA  GAAAAGATAG CCTAACCGCA AGTCAAGAGG ATGCCGATGC CATAATGCCT AGTCCGCGAG CGAACGCAAC CACCCTCATC GATCTCTTTG CCAAATTTGA CCTCTCGGTC AAAGATTTAG  TAGCCCTTTC GGGCTCACAC TCGATTGGTA ACGGGCGTTG TTTCTCCATT GTGTTTAGGC TCTACAATCA ATCAGGCACA GGCCGCCCAG ACCCCTCCAT CGAGCCAAAG TTTAGACAAA  AGTTAGACAA ACTTTGCCCA CTTGGTGGTG ATGGGAATGT CACAGGCGAT TTGGACTTTA CGCCTCGCAT CTTCGACAAT CAATATTTCA AAGATTTGGT AAATGGAAGA GGGTTTTTGA  ATTCTGATGA AACATTGTAC ACTTATTGGA AAACAAGAGA GTATGTTAAA AGGTATAGTG AGGATCAAGA TGAGTTCTTT AGGGACTTTG TTGAGGGGAT GATTAAGATG GGCGACTTAC  AATCGGGGCG GCCCGGGGAG ATTCGGAAGA ATTGTAGGGT GGTCAACGGT GGTCCACCGA TGGACTTGGT GGTGGATGGA TATAAAGATA GGAGGATATT GAGTTATTAG AGTTGAGTTG  AACACATTAT GTATTTATCA TGAATATGGA TAATGTAGCA TATGGTGTCA ACTTTTTATA TAAGTTATAT TAATTAGAGT TGTGGGTTAA AGATTTTCTT TCATTATATA TCAATTTATC 
AATTTTATAA ACTTTGACCC ATGTAAGTTT GT 

Retrieve as FASTA