Entry information : HaPrx94 (HanXRQChr12g0358361)
Entry ID 13648
Creation 2016-05-02 (Christophe Dunand)
Last sequence changes 2016-05-02 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2017-11-23 (Catherine Mathe (Scipio))
Peroxidase information: HaPrx94 (HanXRQChr12g0358361)
Name (synonym) HaPrx94 (HanXRQChr12g0358361)
Class Class III peroxidase    [Orthogroup: Prx025]
Taxonomy Eukaryota Viridiplantae Streptophyta Asteraceae Helianthus
Organism Helianthus annuus (Sunflower)    [TaxId: 4232 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HaPrx94
start..stop
S start..stop
HaPrx78 583 0 1..318 1..318
LsPrx26 570 0 1..318 1..318
HaPrx95 562 0 1..318 15..334
HargPrx04 551 0 1..313 1..315
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 13570858..13571058 201 N° 2 13570567..13570758 192 N° 3 13570273..13570438 166 N° 4 13569495..13569892 398
complement(join(13569495..13569892,13570273..13570438,13570567..13570758,1357085 8..13571058))


exon

Literature and cross-references HaPrx94 (HanXRQChr12g0358361)
DNA ref. HanXRQ genome:   HanXRQChr12 (13571058..13569495)
Protein sequence: HaPrx94 (HanXRQChr12g0358361)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   318 (298)
PWM (Da):   %s   35178.11 (32889.9)  
PI (pH):   %s   10.47 (10.42) Peptide Signal:   %s   cut: 21 range:21-318
Sequence 359
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MKKQILTFLFLSLFVASSYAQLRKNFYQNTCPNVESIVKSAVTKKFRQTFVTAPATLRLFFHDCFVRGCDASVLLANANAEKDHPDNLSLAGDGFDTVIKAKAALDSNPNCRNKVSCADILALATRDVIGLAGGPSYSVELGRRDGRVSTKNSVQQGLPQPHFKLDQLNSMFAKHGLSQTDMVALSGAHTLGFSHCSKFSKRIYNKKGIDRTLNRQYALQLRQMCPLKVDPRIAINMDPTTPRTFDNAYFRNLQQGKGLFTSDQNLFTDTRSRPTVNQFASSNNAFNQAFVTAITKLGRVGVLTGNKGEIRRDCTRRN

Retrieve as FASTA  
Remarks
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAGAAGCAAATACTAACTTTCTTGTTCCTCTCTTTGTTTGTTGCCTCATCATATGCTCAACTTAGAAAAAATTTCTATCAAAACACTTGCCCAAATGTAGAATCAATAGTCAAATCA
GCTGTCACCAAAAAATTTCGGCAAACTTTTGTCACCGCCCCAGCCACTCTACGCCTCTTCTTTCATGACTGTTTTGTTCGG
GTTTGTCTCGTTTAACTTCCGCCATACTCATTTCTAACT
ATGATTACCAGTCATTAATTAACTGTTAACATATTCATTTTTTACTCTATGTTTATATAGGGATGTGATGCTTCGGTTCTTCTAGCGAATGCAAATGCCGAGAAGGACCATCCTGACAAC
TTGTCACTCGCTGGAGACGGATTTGATACAGTCATCAAAGCGAAAGCCGCCCTTGACAGCAATCCCAATTGCCGGAATAAAGTTTCTTGTGCAGATATATTGGCTCTTGCCACTAGAGAT
GTCATTGGTTTG
GTATGAACAATCATATTCTTTTGATGTGACTGTTGATTTTTTGGGTCTCATAGGAAATAAAATATCTTAGTATATATTTATTACATAGATTTGGTTATGTTTATATAT
TTGTTTGTTTAAATAAACAGGCAGGTGGGCCATCATACAGTGTAGAGTTGGGAAGAAGAGATGGGAGGGTTTCTACAAAGAATAGTGTGCAACAAGGTCTTCCACAACCACATTTTAAGT
TGGACCAACTTAATAGCATGTTTGCAAAGCATGGTTTATCTCAAACCGATATGGTTGCACTTTCAG
GTAATTAAATGTGTTTTATAACGCAGCGAGGGAATTCAAAAGAACATAAAAATT
GTATTAATAAAATAATATTTTTATATATAAAATACCTTAACCATACCCCATTATATAGAGATCGTAATGAAAATGATAATGAGAAAACTAACCAACTAATGATAACGGTAAAACGTCAAT
AACTATCATGGTATTCAAACCAGAGATAGAATAATGACTAAAAATGAACTTCAAAGATAAATAATATATCGAATAATAATAACTATAGTAGATAATAAACTCAACTAATAACGGGCTTGA
TCATGCATGTAGATCACGTTATTCATTATGGTTAAAAATATGTCTTTTTGAACACCTTTTATAAATGGTGTTTAATTGTTTTACAGGTGCACATACACTTGGATTTTCTCATTGTAGCAA
ATTCTCGAAACGAATTTATAATAAGAAGGGAATAGACCGGACGCTAAACCGCCAATATGCTCTTCAACTAAGGCAAATGTGTCCGCTTAAAGTAGACCCAAGGATAGCAATTAACATGGA
CCCTACCACCCCTCGAACTTTCGACAATGCGTATTTTAGGAACCTTCAACAAGGAAAGGGTTTGTTTACCTCTGACCAAAATTTGTTCACGGATACTCGATCAAGGCCAACAGTCAATCA
ATTTGCGTCTAGCAACAATGCCTTTAACCAAGCTTTCGTGACCGCCATTACCAAGCTTGGTCGAGTAGGGGTTTTGACGGGTAACAAGGGTGAGATCAGACGTGATTGCACACGACGTAA
CTA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAGAAGCAAATACTAACTTTCTTGTTCCTCTCTTTGTTTGTTGCCTCATCATATGCTCAACTTAGAAAAAATTTCTATCAAAACACTTGCCCAAATGTAGAATCAATAGTCAAATCA
GCTGTCACCAAAAAATTTCGGCAAACTTTTGTCACCGCCCCAGCCACTCTACGCCTCTTCTTTCATGACTGTTTTGTTCGG
GGATGTGATGCTTCGGTTCTTCTAGCGAATGCAAATGCC
GAGAAGGACCATCCTGACAACTTGTCACTCGCTGGAGACGGATTTGATACAGTCATCAAAGCGAAAGCCGCCCTTGACAGCAATCCCAATTGCCGGAATAAAGTTTCTTGTGCAGATATA
TTGGCTCTTGCCACTAGAGATGTCATTGGTTTG
GCAGGTGGGCCATCATACAGTGTAGAGTTGGGAAGAAGAGATGGGAGGGTTTCTACAAAGAATAGTGTGCAACAAGGTCTTCCACAA
CCACATTTTAAGTTGGACCAACTTAATAGCATGTTTGCAAAGCATGGTTTATCTCAAACCGATATGGTTGCACTTTCAG
GTGCACATACACTTGGATTTTCTCATTGTAGCAAATTCTCG
AAACGAATTTATAATAAGAAGGGAATAGACCGGACGCTAAACCGCCAATATGCTCTTCAACTAAGGCAAATGTGTCCGCTTAAAGTAGACCCAAGGATAGCAATTAACATGGACCCTACC
ACCCCTCGAACTTTCGACAATGCGTATTTTAGGAACCTTCAACAAGGAAAGGGTTTGTTTACCTCTGACCAAAATTTGTTCACGGATACTCGATCAAGGCCAACAGTCAATCAATTTGCG
TCTAGCAACAATGCCTTTAACCAAGCTTTCGTGACCGCCATTACCAAGCTTGGTCGAGTAGGGGTTTTGACGGGTAACAAGGGTGAGATCAGACGTGATTGCACACGACGTAACTA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
CTATATAAAC ATCCTCACTC CAAAATCATA CAACAAAGAG AAAAGGAAAG CAAAATGAAG AAGCAAATAC TAACTTTCTT GTTCCTCTCT TTGTTTGTTG CCTCATCATA TGCTCAACTT  AGAAAAAATT TCTATCAAAA CACTTGCCCA AATGTAGAAT CAATAGTCAA ATCAGCTGTC ACCAAAAAAT TTCGGCAAAC TTTTGTCACC GCCCCAGCCA CTCTACGCCT CTTCTTTCAT  GACTGTTTTG TTCGGGGATG TGATGCTTCG GTTCTTCTAG CGAATGCAAA TGCCGAGAAG GACCATCCTG ACAACTTGTC ACTCGCTGGA GACGGATTTG ATACAGTCAT CAAAGCGAAA  GCCGCCCTTG ACAGCAATCC CAATTGCCGG AATAAAGTTT CTTGTGCAGA TATATTGGCT CTTGCCACTA GAGATGTCAT TGGTTTGGCA GGTGGGCCAT CATACAGTGT AGAGTTGGGA  AGAAGAGATG GGAGGGTTTC TACAAAGAAT AGTGTGCAAC AAGGTCTTCC ACAACCACAT TTTAAGTTGG ACCAACTTAA TAGCATGTTT GCAAAGCATG GTTTATCTCA AACCGATATG  GTTGCACTTT CAGGTGCACA TACACTTGGA TTTTCTCATT GTAGCAAATT CTCGAAACGA ATTTATAATA AGAAGGGAAT AGACCGGACG CTAAACCGCC AATATGCTCT TCAACTAAGG  CAAATGTGTC CGCTTAAAGT AGACCCAAGG ATAGCAATTA ACATGGACCC TACCACCCCT CGAACTTTCG ACAATGCGTA TTTTAGGAAC CTTCAACAAG GAAAGGGTTT GTTTACCTCT  GACCAAAATT TGTTCACGGA TACTCGATCA AGGCCAACAG TCAATCAATT TGCGTCTAGC AACAATGCCT TTAACCAAGC TTTCGTGACC GCCATTACCA AGCTTGGTCG AGTAGGGGTT  TTGACGGGTA ACAAGGGTGA GATCAGACGT GATTGCACAC GACGTAACTA AAAAACAACT ATGTGGTTTC CATTCGTTAT TGAATTATAT TCCTAAGTGT AGATTTAATG TTTAAAATAA  GTAGCTACCA ATGTTCACAT TGTAGCTTTT GAAGGAGTCA TGTTGGTTTG GTTTTCATAT TGTAACATTT GGTCTTGAGG TTGTAAATGT TGACATCAAA TGCTAATATT TCCTTGTTCC 
AGAAAAGTTT ATTTGAACAA ACCCATTTTC ATCATATCAT T 

Retrieve as FASTA