Entry information : HaPrx95 (HanXRQChr12g0358371)
Entry ID 13649
Creation 2016-05-02 (Christophe Dunand)
Last sequence changes 2016-05-02 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2017-11-23 (Catherine Mathe (Scipio))
Peroxidase information: HaPrx95 (HanXRQChr12g0358371)
Name (synonym) HaPrx95 (HanXRQChr12g0358371)
Class Class III peroxidase    [Orthogroup: Prx025]
Taxonomy Eukaryota Viridiplantae Streptophyta Asteraceae Helianthus
Organism Helianthus annuus (Sunflower)    [TaxId: 4232 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HaPrx95
start..stop
S start..stop
HargPrx04 638 0 15..329 1..315
HaPrx79 593 0 15..334 1..319
HaPrx78 581 0 15..334 1..318
HaPrx94 562 0 15..334 1..318
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 13581376..13581624 249 N° 2 13581098..13581289 192 N° 3 13580398..13580563 166 N° 4 13579904..13580301 398
complement(join(13579904..13580301,13580398..13580563,13581098..13581289,1358137 6..13581624))


exon

Literature and cross-references HaPrx95 (HanXRQChr12g0358371)
DNA ref. HanXRQ genome:   HanXRQChr12 (13581624..13579904)
Protein sequence: HaPrx95 (HanXRQChr12g0358371)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   334 (300)
PWM (Da):   %s   36969.62 (33017.7) Transmb domain:   %s   i19-36o
PI (pH):   %s   9.71 (9.62) Peptide Signal:   %s   cut: 35 range:35-334
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MPTILTTMMKTETKMKMQMLCFLFFSFLVASSYAQVKLKQNFYQNTCPNVESIVRSAVTKKFQQTFVTAPATLRLFFHDCFVRGCDASVMLANGNAEKDHHDDLSLAGDGFDTVIKAKAAVDSNPSCRNKVSCADILALATRDVVALTGGPSYNVELGRRDGRISTKKSVQHKLPHADFNLDQLNTMFASHGLSQTDMIALSGAHTLGFSHCGQFKKRIYSKAGIDRTLNRQYALQLRQMCPVNVDPRIAINMDPTTPQTFDNAYYKNLEQGKGLFSSDQVLFTDKRSRPTVNLFASNNNAFNQAFVNAITKLGRVGVLTGNQGEIRRDCTRVN

Retrieve as FASTA  
Remarks
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCCCACCATCTTAACTACAATGATGAAAACGGAAACCAAAATGAAGATGCAAATGCTATGTTTCTTGTTCTTCTCTTTCCTTGTTGCTTCATCATATGCTCAAGTTAAACTTAAACAA
AACTTCTATCAAAACACTTGCCCAAATGTCGAATCAATCGTTAGATCTGCCGTCACTAAAAAGTTCCAGCAAACGTTTGTCACCGCTCCGGCCACTCTCCGCCTCTTCTTTCACGACTGT
TTCGTTCGG
GTTCGTTTAACTATCCATATACAAACTTATTAAATTTTGTAATATGATCAATTGTATTCAATGTTATGGTTATGTATGTTGTATAGGGATGTGATGCTTCGGTTATGTTAG
CAAATGGAAATGCGGAGAAGGACCATCATGATGACTTGTCGTTGGCCGGAGATGGATTCGACACGGTTATCAAAGCGAAGGCCGCGGTTGACAGCAATCCAAGTTGCAGGAATAAAGTTT
CTTGTGCGGATATATTAGCTCTTGCCACAAGAGATGTTGTAGCTTTG
GTGAGTATTGCCTCAAGACTTGTGGTTACCATTTGAACCAATTTAATGATTTTAAAGTTTTAGGCAGATTGGA
CTTCAATCATCCAAACTAAACTCATTTCCTGATAATAATTTATAGTAACAATGCGAAAAATGACACTCATAACTTTCACTTTTGTTGTTCAGGGTTGTTTTCACCTTATTACGTGTTCAA
GGTTGTTTCACTTTAACAGAAAAGTAACTACGACTGCCGCTAATGAATGTTGTAAATTGTGTTGAAATATAATATAATAATAAATGGAAGTTAGGGGCAGAAGAACTTACTTTACGTTAG
AGTGAATTTGTTTTTGGCAACGGAAAGGAAAAAGTCATAAGTTTACTTTGTCACATACCAGCATGAATGAGTCATTGTTTTAAAATTACTACCAATTTGCCTATCACCTTTTATAGCTAA
ACTAATATGATTCAATCTATTTATATTCTTCAAAATGGCAACTCAACATTTTAAAATGTTTTTTTTTTTTGTGGCTTAATTTTTTTATTTATAATATACAGACAGGTGGGCCATCGTACA
ACGTTGAATTAGGAAGGAGAGATGGAAGAATCTCTACCAAAAAAAGTGTTCAACACAAGCTTCCACATGCAGATTTTAACCTAGACCAACTCAACACCATGTTTGCCTCTCATGGTCTAT
CTCAAACCGATATGATTGCACTTTCAG
GTAAACTAATTGATCCACATGGTTGATTAATTAACGGTACCAAACTAAAACATATATTTTAACACACACTTTATCATGTAAACTATTGTTTTC
TAGGTGCGCATACGCTAGGATTCTCTCACTGTGGTCAATTTAAAAAACGTATCTATTCAAAGGCTGGAATAGACCGGACGCTAAATCGACAGTATGCTCTTCAGCTACGACAAATGTGTC
CAGTTAATGTAGACCCTAGGATTGCGATTAACATGGACCCTACCACCCCGCAAACTTTTGACAACGCGTATTATAAGAACCTTGAACAAGGGAAGGGGTTGTTTAGCTCGGACCAAGTCT
TGTTCACGGACAAGCGATCAAGGCCAACGGTTAATCTATTTGCTTCAAACAACAATGCCTTTAATCAAGCGTTTGTGAACGCTATCACCAAGCTTGGCCGTGTTGGGGTTTTGACAGGAA
ACCAGGGCGAAATCAGGCGTGACTGTACTAGAGTTAATTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCCCACCATCTTAACTACAATGATGAAAACGGAAACCAAAATGAAGATGCAAATGCTATGTTTCTTGTTCTTCTCTTTCCTTGTTGCTTCATCATATGCTCAAGTTAAACTTAAACAA
AACTTCTATCAAAACACTTGCCCAAATGTCGAATCAATCGTTAGATCTGCCGTCACTAAAAAGTTCCAGCAAACGTTTGTCACCGCTCCGGCCACTCTCCGCCTCTTCTTTCACGACTGT
TTCGTTCGG
GGATGTGATGCTTCGGTTATGTTAGCAAATGGAAATGCGGAGAAGGACCATCATGATGACTTGTCGTTGGCCGGAGATGGATTCGACACGGTTATCAAAGCGAAGGCCGCG
GTTGACAGCAATCCAAGTTGCAGGAATAAAGTTTCTTGTGCGGATATATTAGCTCTTGCCACAAGAGATGTTGTAGCTTTG
ACAGGTGGGCCATCGTACAACGTTGAATTAGGAAGGAGA
GATGGAAGAATCTCTACCAAAAAAAGTGTTCAACACAAGCTTCCACATGCAGATTTTAACCTAGACCAACTCAACACCATGTTTGCCTCTCATGGTCTATCTCAAACCGATATGATTGCA
CTTTCAG
GTGCGCATACGCTAGGATTCTCTCACTGTGGTCAATTTAAAAAACGTATCTATTCAAAGGCTGGAATAGACCGGACGCTAAATCGACAGTATGCTCTTCAGCTACGACAAATG
TGTCCAGTTAATGTAGACCCTAGGATTGCGATTAACATGGACCCTACCACCCCGCAAACTTTTGACAACGCGTATTATAAGAACCTTGAACAAGGGAAGGGGTTGTTTAGCTCGGACCAA
GTCTTGTTCACGGACAAGCGATCAAGGCCAACGGTTAATCTATTTGCTTCAAACAACAATGCCTTTAATCAAGCGTTTGTGAACGCTATCACCAAGCTTGGCCGTGTTGGGGTTTTGACA
GGAAACCAGGGCGAAATCAGGCGTGACTGTACTAGAGTTAATTAA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGTACTCAGT AGTCAGTACT TATATATGCC CACCATCTTA ACTACAATGA TGAAAACGGA AACCAAAATG AAGATGCAAA TGCTATGTTT CTTGTTCTTC TCTTTCCTTG TTGCTTCATC  ATATGCTCAA GTTAAACTTA AACAAAACTT CTATCAAAAC ACTTGCCCAA ATGTCGAATC AATCGTTAGA TCTGCCGTCA CTAAAAAGTT CCAGCAAACG TTTGTCACCG CTCCGGCCAC  TCTCCGCCTC TTCTTTCACG ACTGTTTCGT TCGGGGATGT GATGCTTCGG TTATGTTAGC AAATGGAAAT GCGGAGAAGG ACCATCATGA TGACTTGTCG TTGGCCGGAG ATGGATTCGA  CACGGTTATC AAAGCGAAGG CCGCGGTTGA CAGCAATCCA AGTTGCAGGA ATAAAGTTTC TTGTGCGGAT ATATTAGCTC TTGCCACAAG AGATGTTGTA GCTTTGACAG GTGGGCCATC  GTACAACGTT GAATTAGGAA GGAGAGATGG AAGAATCTCT ACCAAAAAAA GTGTTCAACA CAAGCTTCCA CATGCAGATT TTAACCTAGA CCAACTCAAC ACCATGTTTG CCTCTCATGG  TCTATCTCAA ACCGATATGA TTGCACTTTC AGGTGCGCAT ACGCTAGGAT TCTCTCACTG TGGTCAATTT AAAAAACGTA TCTATTCAAA GGCTGGAATA GACCGGACGC TAAATCGACA  GTATGCTCTT CAGCTACGAC AAATGTGTCC AGTTAATGTA GACCCTAGGA TTGCGATTAA CATGGACCCT ACCACCCCGC AAACTTTTGA CAACGCGTAT TATAAGAACC TTGAACAAGG  GAAGGGGTTG TTTAGCTCGG ACCAAGTCTT GTTCACGGAC AAGCGATCAA GGCCAACGGT TAATCTATTT GCTTCAAACA ACAATGCCTT TAATCAAGCG TTTGTGAACG CTATCACCAA  GCTTGGCCGT GTTGGGGTTT TGACAGGAAA CCAGGGCGAA ATCAGGCGTG ACTGTACTAG AGTTAATTAA AAAAATGATG ATTATTTTTC TTGAATAAGT AGCTACAATT GTTCAAATGT  ACCTATGCAA GTAGTTTTCG AAGAACAGTT CGATTATGTT GAATATAATT TGAATATATA ATAAATACTT TATGTGAATT GTGATATATC TTTAAGTTGC ACACTACTAG AAAACAGCCA 
GATTTACGAC AAGCATATTT GTAGCAAATC TGTGGAAAAT TGGCCTTAGC TACAAATTTG CGACAAAACA G 

Retrieve as FASTA