Entry information : Ha2CysPrx01 (HanXRQChr01g0025631)
Entry ID 13663
Creation 2016-05-11 (Christophe Dunand)
Last sequence changes 2016-05-11 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2017-11-23 (Catherine Mathe (Scipio))
Peroxidase information: Ha2CysPrx01 (HanXRQChr01g0025631)
Name (synonym) Ha2CysPrx01 (HanXRQChr01g0025631)
Class Typical 2-Cysteine peroxiredoxin    [Orthogroup: 2CysPrx001]
Taxonomy Eukaryota Viridiplantae Streptophyta Asteraceae Helianthus
Organism Helianthus annuus (Sunflower)    [TaxId: 4232 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value Ha2CysPrx01
start..stop
S start..stop
Ha2CysPrx03 421 3e-151 14..260 15..256
Ha2CysPrx02 417 8e-150 27..260 32..265
Pv2CysPrx01-1 400 7e-143 1..260 1..260
LePrxII03 399 1e-142 1..260 1..267
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 137959341..137959532 192 N° 2 137961079..137961150 72 N° 3 137961255..137961336 82 N° 4 137961413..137961492 80
N° 5 137961589..137961714 126 N° 6 137961872..137961985 114 N° 7 137963237..137963350 114  
join(137959341..137959532,137961079..137961150,137961255..137961336,137961413..1 37961492,137961589..137961714,137961872..137961985,137963237..137963350)


exon

Literature and cross-references Ha2CysPrx01 (HanXRQChr01g0025631)
DNA ref. HanXRQ genome:   HanXRQChr01 (137959341..137963350)
Protein sequence: Ha2CysPrx01 (HanXRQChr01g0025631)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   260
PWM (Da):   %s   28374.68  
PI (pH):   %s   7.34
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASLSASAALLSSNPRYISPKSSNLSQTLSFLGSSSVNFRSKSLRSALAVRPSASRCNGSLIKAALPLVGNKAPDFEAEAVFDQEFIKVKLSDYIGKKYVILFFYPLDFTFVCPTEITAFSDRYAEFEKINTEILGVSVDSFSHLAWVQTDRKSGGLGDLNYPLVSDVTKSIAKAFNVLIEDQGIALRGLFIIDKEGVIQHSTINNLAIGRSVDETMRTLQALQYVQENPDEVCPAGWKPGEKSMKPDPKLSKEYFAAV

Retrieve as FASTA  
Remarks
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGTCTTTATCTGCTTCTGCTGCTCTTCTTTCTTCAAACCCTAGATACATTTCCCCCAAATCATCCAATCTATCTCAAACCCTAAGTTTCCTCGGCTCTTCTTCCGTCAATTTCCGA
TCCAAATCTCTCCGCTCCGCCCTCGCCGTTCGTCCCTCGGCCTCCCGTTGCAACGGATCCCTTATCAAAGCT
GTAAGTAGTTCAATTCACCGTTCACGGAATTATGTTTATTTGTTATTA
GTAGTAGTAGTAGTTGAATTTATGGTTGACTGAATTCTGTTTGTTAGAATTTGTTGAATTTATCGTTGACTGAAATCTGTTTGTCTGAGTGACGTGATTGATATGTTTGTGTTGTTAATT
ACTTGCTAAAGAAGTTAGAAATGTAAGCGTTAAGTTGAGATATTAGATACTACTGGTTAGGACAAATATCGATACGCTGCAGTTGGATTAAGAGTAAATTAAGTTTGGAAGCATTTCAAT
CATAGTTATTAAAGGCGTTAGCGCACTCAAGGCGCATAGGTCTCGCTTCGGGCCTAGGCGCAAGGCGCAAAAGAAACGCAGGCCTGAGAAAAAAAAAGCGCACAGCGAAAAAAACTCAAA
ATATTTATATATAATAGAAAATTAATACCATCCTTCATATAAAAAAAAAACTAAAGCTATTATATAACATTTAATATCGTCTACTTAGTACCAGAAGTTTTAAAATGCTAGTATATCTGT
GTAGAAAAATAGTTTTCGTTAGATAAAAGTATAAATTTAGCTGGAATCTTGCCAGAATTTAGAGAATTTGGCCGGAAACTCTTCAGAATCTAGGAATCTCGCTGGAATATGCGCAGAACC
ATCACCCAAAGAATTAAAGCGCAATTGCCTTGACTTAAGGCGCAATTGCCTCGCCTTGCTAGGAAATTGGGCCTAGGCGCAAGAGGCGATGGCTTTTAACAACTATGATTTCAATTGGCT
TTTCATTTCAAGTTATGTAATTATCCACAAAGAGATGGAGGACTGTGAAACAACGAGCGATTTTGGATGAAGAAAATGTTGAATATGGTGTTTTTTTTCGGATTTATACATTCAGTGTCA
AAATTGGCTCATTTTGTTATGAAGTATGATTTCTTTTGGCATTTTTTAAGAAGAATGATGATTATTGATTAGTTTGTAACGAAGAGCCAAGTATGATGATATAATTTGAGATCTTGTTGA
TGTAATTGTGGAATTAGAATTGATTGATTGACTTGGTTCCACCTGTTAGTTTTATAGTTGTGCAAATAATGACGCCTTAGTGTACTCGGTGTTGTAAGGCAGTAAGGTTACTTGTGGGTA
TGGGGATACACGTGTGTGATTCGTAAAACAAGGATATGTGTGCATTCATATATGTGTTTATCTGTGTAAATATGTACAGTCTTAAGATTGAAACAATATAAGAAAAAAAGTTATTTCATG
ATTTATACATTTAATTTGTAAATAAAGAGCACACATAGGCCTAACTTTGTTTTGTCACTTTACCTTATGTGTTCATTTTTGGAACGGAAACCCATTTCACGGATAAAACAAGTGAATTAT
TACTATTATAGTTAAAGCTCTGATATTCCACATTTTTAGTCCATGAGTGAATTATTACTATTATAGTTAAAGCTCTGATGTTCCACATTTTTAGTCCATGATTCTTTAGCATTTTGTATC
CTTATTGACATTAATATTTATTTGCCATCTTTTATCTAAACTCCGTTTCTTTATGTAGGCACTACCATTAGTTGGAAATAAGGCACCAGATTTTGAAGCAGAAGCTGTTTTTGATCAAGA
ATTCATCAAA
GTAATTAAATTATCAGTACCTTGCCTTCGTATTTTTTGATAGAATTAATATTAGTCACAAAAAAATCAGGAACTTTTGTAATTTTCGGAACTATGCAAATGCAGGTTAAG
CTCTCTGATTATATCGGGAAGAAATATGTCATTCTCTTCTTCTACCCTTTGGACTTCACTTTCGTTTGTCCAACCG
GTGAGCATGTTTTAAGTCAAATTATATAATATTCTTGGTTGAAC
AAATTTCTTATTTAATATTCTTGGTTGTACAGAAATCACTGCTTTCAGTGACCGTTATGCTGAATTTGAGAAGATAAATACCGAAATATTGGGGGTTTCCGTAGACAGTGTGGTATGATT
GTTTAAGTTTAACGGGGCATTTGGTTTGTACATATAAGATTATCACAATGTTATTTATTTATTTATTTATTTTTGTTTTCTTTTATAGTTCTCCCATCTTGCATGGGTTCAAACAGACAG
AAAATCCGGAGGTCTTGGTGATCTGAACTACCCATTAGTTTCGGATGTAACCAAGTCAATTGCGAAAGCTTTTAATGTGTTGATCGAAGACCAG
GTACGCCTTTTGTTATATGCGTAAAC
ACACTCGTATTATTATTAATGTTATTGTTACTGTTACTGTTCACACCTATATACGTGGATATGTACTTTTTGTAACCTAAATTGTAAACAATTAATGAAAATAATAATCTTTCTTGATCT
TTACATTTCAGGGAATCGCGTTGAGAGGACTTTTCATAATTGACAAAGAAGGCGTTATTCAACACTCCACGATCAATAATCTTGCAATTGGTAGAAGTGTAGATGAAACAATGAGAACAC
TTCAG
GTAGATAATTATTTACTTGTTACGCCCCGCTGGCGGTATGCGCATATAATGTATATATGTGTGGGCGCTCGGGGGGCAAAAGTGAAACTTCACTAGTTTTAACGTTATTTTTACT
AATTTCGTGAAAATAACGTTAAAAGAGGGGGATGGTTAATCATGCATCATGTGGTGGCGTTGATAGCCGAAAGACAAGGGAGTACATGCACTAATCGGCCGTTGTCTTAATTGCTGAGTG
TTATGTGCCTTATGTCCAAGGCTTGATGCAAAACTACTATCGAGTCGGGGGTCTCACTGGAAGCAGCCTCTCTATTCTTAACGGGTAGAGGTAAGGCTGTCTGCATCTTACCCTCCACAG
ACCCTACCTTAGCTTTGCTGAGTATGATGATGATGAGATTTTACTTGTCTTCCACTCAAACTCAATGTTACCATCCATGTTTTCATAACTGGACAGGTCATCGAACTGACAAATGGACCG
GTTTAAAAAACCGTATAACTTCATAAATAGTTTAAAATTTTGAGTAAAATGCCAAATCGTCCTTGAGGTTTTTGGGCGCTTTTTCTTGTTCCCATCCCAAATAAGAATTTTTTGTAACTG
GACCCCTGACGTTTCATTTTTGTTGTCATTTCCATCCAATTTGCAATTCTCAAATCTCAGGGATGATTTTGTATTTTATTTTTTGTCACTATCGTCCCTGAGGTTTGGGAATTGCCAAAA
TCATCCATGACTTAACAATATATTTTAACTGAGTTAGTGATTTGGATGGAAATGGCAACAAAAATGAAACGCCAGGGTCCAGTTACAAAAAAAATCTTATTTTGGATGGAACAAGCAAAA
GTGCCCAAACCTCAGAGACGATTTTGGCATTTTACTCAAAATTTATATATATTAAATTTAAGGGAATATTTCACAGAATAATAACCAAGTTTTAAAAGTATGAAATCAGCTTATCTTTTG
GTGTGGATTTAGAATGTTAACATAATATAATAGTGATTGAATCAGTAAATGAGATTTAAGAAGGATTTTTTTTTTTTAAAATCCAACCTAACCACCTGGTGTGGTTTTGACGGTCCGACC
GGTTGGACTCGACCAGACCGGTCATGTAATGTAGCTGGTTCTCGGTCCGACTGGCTGGTCAGTGAGGCTATGAAAACATTGGTTATCATTCTAAATGATAATGTCCGTTTAGGCTTGTCA
ACATCTCTGTATTTGAACATTTGACCAAAAACATGTTACGGGTGGTTGTACTGTAGGCATTGCAATATGTACAAGAGAACCCCGATGAGGTATGCCCAGCTGGATGGAAGCCAGGGGAGA
AATCAATGAAACCAGACCCTAAACTCAGCAAGGAGTACTTTGCAGCAGTA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGTCTTTATCTGCTTCTGCTGCTCTTCTTTCTTCAAACCCTAGATACATTTCCCCCAAATCATCCAATCTATCTCAAACCCTAAGTTTCCTCGGCTCTTCTTCCGTCAATTTCCGA
TCCAAATCTCTCCGCTCCGCCCTCGCCGTTCGTCCCTCGGCCTCCCGTTGCAACGGATCCCTTATCAAAGCT
GCACTACCATTAGTTGGAAATAAGGCACCAGATTTTGAAGCAGAAGCT
GTTTTTGATCAAGAATTCATCAAA
GTTAAGCTCTCTGATTATATCGGGAAGAAATATGTCATTCTCTTCTTCTACCCTTTGGACTTCACTTTCGTTTGTCCAACCGAAATCACTGCTTTC
AGTGACCGTTATGCTGAATTTGAGAAGATAAATACCGAAATATTGGGGGTTTCCGTAGACAGTGTG
TTCTCCCATCTTGCATGGGTTCAAACAGACAGAAAATCCGGAGGTCTTGGTGAT
CTGAACTACCCATTAGTTTCGGATGTAACCAAGTCAATTGCGAAAGCTTTTAATGTGTTGATCGAAGACCAG
GGAATCGCGTTGAGAGGACTTTTCATAATTGACAAAGAAGGCGTTATT
CAACACTCCACGATCAATAATCTTGCAATTGGTAGAAGTGTAGATGAAACAATGAGAACACTTCAG
GCATTGCAATATGTACAAGAGAACCCCGATGAGGTATGCCCAGCTGGATGGAAG
CCAGGGGAGAAATCAATGAAACCAGACCCTAAACTCAGCAAGGAGTACTTTGCAGCAGTA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
AATCTTTGAT GCTATTTTGA CCTAAAGTCA ACAAAACAAG TCTACCAACT ACCAAAACAG TCCAAAACCC ATCATCACTA TGCCAATCAT TGTGATTTAT CACATTCTCT TCACCACACA  AACCCTAGGC TCCATCATCA CTGACGTTAA CAGAAGATCG ATCGATCGAT CAAACAATGG CGTCTTTATC TGCTTCTGCT GCTCTTCTTT CTTCAAACCC TAGATACATT TCCCCCAAAT  CATCCAATCT ATCTCAAACC CTAAGTTTCC TCGGCTCTTC TTCCGTCAAT TTCCGATCCA AATCTCTCCG CTCCGCCCTC GCCGTTCGTC CCTCGGCCTC CCGTTGCAAC GGATCCCTTA  TCAAAGCTGC ACTACCATTA GTTGGAAATA AGGCACCAGA TTTTGAAGCA GAAGCTGTTT TTGATCAAGA ATTCATCAAA GTTAAGCTCT CTGATTATAT CGGGAAGAAA TATGTCATTC  TCTTCTTCTA CCCTTTGGAC TTCACTTTCG TTTGTCCAAC CGAAATCACT GCTTTCAGTG ACCGTTATGC TGAATTTGAG AAGATAAATA CCGAAATATT GGGGGTTTCC GTAGACAGTG  TGTTCTCCCA TCTTGCATGG GTTCAAACAG ACAGAAAATC CGGAGGTCTT GGTGATCTGA ACTACCCATT AGTTTCGGAT GTAACCAAGT CAATTGCGAA AGCTTTTAAT GTGTTGATCG  AAGACCAGGG AATCGCGTTG AGAGGACTTT TCATAATTGA CAAAGAAGGC GTTATTCAAC ACTCCACGAT CAATAATCTT GCAATTGGTA GAAGTGTAGA TGAAACAATG AGAACACTTC  AGGCATTGCA ATATGTACAA GAGAACCCCG ATGAGGTATG CCCAGCTGGA TGGAAGCCAG GGGAGAAATC AATGAAACCA GACCCTAAAC TCAGCAAGGA GTACTTTGCA GCAGTATAAT  TTTGGGAGCA CTTGTGGAAA GAAACAAGAT CTCCTGCCTT GTGAAATTGG AGTTATGAGT GTATCTTGTT TTAAAACATT GTTCTATCTA ATGAGGTTTT GGCATAATAA ATTTGTGGTT  ATATAATAAA TGAATGATTT AACAAGTATA TTTAAAAAAA AAGGTTATTG GATTTTATCA CCCCAATTAT CGGCTTTTGG CCGTTGCCAC CCTCAACTAA CACTTTGACA CCCGACACCT 
TCAACTTGAC TTTTAGTTTG TGCTGTCACC ACTCTCTTAA CTCATTACTA ACAGAGTTAG TTTCTGATCC TAGGTGTCAC AACTTACTTT ACGTGTACAG GATG 

Retrieve as FASTA