Entry information : Ha2CysPrx02 (HanXRQChr02g0053771)
Entry ID 13664
Creation 2016-05-11 (Christophe Dunand)
Last sequence changes 2016-05-11 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2017-11-23 (Catherine Mathe (Scipio))
Peroxidase information: Ha2CysPrx02 (HanXRQChr02g0053771)
Name (synonym) Ha2CysPrx02 (HanXRQChr02g0053771)
Class Typical 2-Cysteine peroxiredoxin    [Orthogroup: 2CysPrx001]
Taxonomy Eukaryota Viridiplantae Streptophyta Asteraceae Helianthus
Organism Helianthus annuus (Sunflower)    [TaxId: 4232 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value Ha2CysPrx02
start..stop
S start..stop
Ha2CysPrx03 446 4e-161 26..265 17..256
Ha2CysPrx01 444 3e-160 17..265 14..260
Hc2CysPrx 413 8e-148 1..265 1..272
Nt2CysPrx01-1A 412 1e-147 1..265 1..271
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 158347423..158347629 207 N° 2 158346171..158346242 72 N° 3 158345669..158345750 82 N° 4 158345490..158345569 80
N° 5 158345286..158345411 126 N° 6 158345085..158345198 114 N° 7 158344256..158344369 114  
complement(join(158344256..158344369,158345085..158345198,158345286..158345411,1 58345490..158345569,158345669..158345750,158346171..158346242,158347423..1583476 29))


exon

Literature and cross-references Ha2CysPrx02 (HanXRQChr02g0053771)
DNA ref. HanXRQ genome:   HanXRQChr02 (158347629..158344256)
Protein sequence: Ha2CysPrx02 (HanXRQChr02g0053771)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   265
PWM (Da):   %s   28920.84  
PI (pH):   %s   7.34
Sequence 306
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MACSSSAASATLLSSLNPRSSSSSSFISPKLQTLSFSSSSSFNFQSKSLRSSVSLRRSAARRNAFVVKAGLPLVGNQAPDFEAEAVFDQEFIKVKLSEYIGKKYVILFFYPLDFTFVCPTEITAFSDRYAEFEKINTEILGVSVDSVFSHLAWVQTDRKSGGLGDLNYPLVSDVTKSISKAFNVLIEDQGIALRGLFIIDKEGVIQHSTINNLAIGRSVDETLRTLQALQFVQENPDEVCPAGWKPGEKSMKPDPKGSKEYFAAI

Retrieve as FASTA  
Remarks
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTGTTCTTCATCTGCTGCTTCCGCAACTCTTCTTTCTTCCTTAAACCCTAGATCTTCTTCTTCCTCCTCTTTCATTTCCCCCAAGCTTCAAACCCTAAGCTTCTCATCCTCTTCC
TCCTTCAACTTCCAGTCAAAATCCCTCCGCTCCTCCGTCTCCCTCCGCCGTTCCGCCGCTCGCCGGAATGCGTTCGTCGTCAAAGCT
GTAAGTTCTTCTTCCTCGTTCAGTTTTGTGTTC
ACTCGATTGTTATATGTTTGTTGTTTGTTAGATTTATGCATCTTCTATTGTGTTAGTGTATATGGTAATGTGTTTCAATTTGATGACATTTTTTGTAAATATTGTCAATTTGCACAGCAT
TAGTTTGTTATAGATGAATGACACTGTTATGGACTAATACCATTGCAAGGTATGCCTCTCTCACCCACCATACTAGTCTTTTGGGTTGTGTTCTCCTGTTTGGTATATAACATTGGTATC
AGAGCCAGGTTTCGATCCTGGGACCTGTGGGTCACGGCCATGTTGGTCACGGCTGGCTCTTTCCAGGCCACCACTCCGTGGACCACCACTCCGAGTTCTGGCTCTGATACCAATGTTATA
TACCAAACAGGAGAACACAACCCAAAAGACTAGTCTGGTGGGTGAGAGAGCCCATTTGGTATATAAACCGATGTGGGACAAGTCCCATACCTTGCAATGGTATTAGTCCATAACAGACAC
TGTTTTACATAAGTTAAATATTCTAAGGGCTTAGCCAAAGAAACACACTATCCAGACACCACTAACGTGTCACACAGCCCATAAGACGTCATAAATGGTCATAGGGTTGTACGGCAGGCG
AAAAATGGCCATATGTTTGTATTAGGGCCTATATGATGTGTTTGACTTATACAGAATTGAATGTGGCCACTGACAAAGTCATACGACCGAATGACCATTTTTTGCCCTAATCATACAGTC
TATATGACATTATACGACCTGGATGATGTGACGGACACACTGGTGTATGCATTTGAGGTGGTGTCTCTTTAGCATCACCATATCCTAATAGCTAAAGCAACTTTTATGATCACATATATT
GATTAATTAGGAAGTAAATGTAGCCTTATCGGGTCTGTAAAAGGTGTAGTTTGATCTTAGTATTTATAAGACTTAAGGTTAGGAAATGAATCTTGAACACTAAAGTGTCCAATGAATCAA
AAGTTTCTGGTGGAATTATGTTTTTAAAACTACCATATGCGCACTGGCTGAAATTCTAGCCCGAAAGGCAGCAACTGTATTATATATTTGAAACAGGGTTTTGAATAATGCTGGCTGTCA
AATATTCATTGTATCCGTAATCCGTTTGTGTAAGCGATCTCTTATACTGACTTTTTGTTGTGTGTAGGGTCTGCCACTAGTTGGGAATCAGGCACCGGACTTTGAAGCGGAGGCTGTTTT
TGATCAGGAGTTCATCAAG
GTAATAGAAGTCACTTATGATACATAGCTTTGAAACAATATATTGTTTGAGTTGCAACTAAGAAAAATGGCATTATCGTGATTTTCTCTTTTATTTATGCC
ACCAATCCGCCATAGTACTCTATTTATTTCCTGTTTGTCGAATGATTATATGCACTTTCTGCTTAAAAAGTCTTTTTTTATCACTTAATGTATACAGCAGTCATACTCATATACGATATC
CAATTATGAATATATATAATGCATTTTAGGATTATATGTGAATTATATGAGCCCTCTATTGTAATAATCACAGTATATATCCTAAAAAAATATTCTAATATTTTTTGATATATAAAATTC
AGGAAGTTCTTACTTCTTACTCAAAAGAATTTCAAAATTTATATAACCTTGTAACGTGTAAGTAATTTTGTCATTGCAGGTTAAGCTCTCTGAATACATCGGCAAGAAATACGTCATTCT
CTTTTTCTACCCTTTGGACTTCACTTTTGTTTGTCCAACAG
GCGAGTAACGCATTACCTGTCAAACACGAAACCCTTCTTTTCTTTTTTCATTTCTGTAGATATAATCCAAGTTTTACTA
ATTTTGTTATCTTAATGTAGAAATCACCGCATTCAGTGACCGATATGCAGAATTTGAGAAGATAAATACCGAGATATTGGGCGTTTCCGTAGACAGTGTGGTAATTGTTACTTACATTTT
TATGTATTTTATTTATTTGTTTATTTTTTTTGAGAATATTTGGCATTTTGTTTTGTAGTTTTCCCACCTTGCATGGGTTCAAACAGATAGAAAATCTGGGGGTCTTGGTGATTTGAACTA
CCCACTGGTTTCCGATGTTACAAAATCGATTTCAAAAGCTTTTAACGTGTTGATTGAAGACCAG
GTACACATCTGTAAATTATTTAAATATTTGGGCGGTTTATATACAAATAAATATTT
ACCGTGCCACAATGTTGTTCTTCAATTTCAGGGAATAGCATTAAGAGGACTTTTTATTATTGACAAGGAAGGTGTTATCCAACATTCCACAATTAACAATCTTGCCATCGGCCGCAGTGT
CGATGAAACATTGAGAACACTTCAG
GTATGTACATAAATCATACGCAGGCTGAGTAACGTGTCAAAATGAGTTATATATAGTATAGATCGGGATGTAACAAATATGATTAGGAAAATAAA
ACATTTCATTAATCATCTATGTATTTAAATAAAATAATGAGTAAAATGCCATTTTCGTCCCTGAGATTTGTCCAGTTTTGCGACTTTCGTCCAAAGGTTTGTTTTTTCGCATCTGCATCC
AAAAGGTTTGAAATCTTTGCCATTTTCATCCAACTCGTTATATCCATCGATTTTTCTCCGTTAAGGCAAGTGTTTTCTCGTCTTTTTTGAATACTTGTACATTATGCTAAATGCTTGTAC
ATAAAGTGAAAAGGACCGAATTACCTTTTAACTTAACAAAAAAACGAAAATACCCCTACCGTAACGGAGAAAAATGGATGGAGTTAATGAGCCAGATGAAAATGATAAGATTTTAAACCT
TTTGGATCTAGATGCGGAAAAACAAACATTTAGACGAAAGTCGCAAAAACTGGCCAAACCTCAGGGATGAAATTGGCATTGTACTCTAAAAATAATTTAGGAGGTATTATTATTTATTAA
AAACACACTTTGGTTGTCATCAACTTGTTTCCTTCTTAGCTGTCTCTTTATTTTACCCATTTTGACCCGTTTGAGATAAAGCCTGTTTGTAATATGTTAAAAGCTCATTGTTAAATTGGG
TTTGTGTGTTTGTACCATAGGCATTGCAATTTGTACAAGAGAACCCGGATGAGGTATGCCCGGCTGGATGGAAGCCCGGGGAGAAGTCGATGAAGCCCGACCCTAAGGGCAGCAAGGAAT
ACTTTGCAGCCAT

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTGTTCTTCATCTGCTGCTTCCGCAACTCTTCTTTCTTCCTTAAACCCTAGATCTTCTTCTTCCTCCTCTTTCATTTCCCCCAAGCTTCAAACCCTAAGCTTCTCATCCTCTTCC
TCCTTCAACTTCCAGTCAAAATCCCTCCGCTCCTCCGTCTCCCTCCGCCGTTCCGCCGCTCGCCGGAATGCGTTCGTCGTCAAAGCT
GGTCTGCCACTAGTTGGGAATCAGGCACCGGAC
TTTGAAGCGGAGGCTGTTTTTGATCAGGAGTTCATCAAG
GTTAAGCTCTCTGAATACATCGGCAAGAAATACGTCATTCTCTTTTTCTACCCTTTGGACTTCACTTTTGTTTGTCCAACA
G
AAATCACCGCATTCAGTGACCGATATGCAGAATTTGAGAAGATAAATACCGAGATATTGGGCGTTTCCGTAGACAGTGTGTTTTCCCACCTTGCATGGGTTCAAACAGATAGAAAATCT
GGGGGTCTTGGTGATTTGAACTACCCACTGGTTTCCGATGTTACAAAATCGATTTCAAAAGCTTTTAACGTGTTGATTGAAGACCAG
GGAATAGCATTAAGAGGACTTTTTATTATTGAC
AAGGAAGGTGTTATCCAACATTCCACAATTAACAATCTTGCCATCGGCCGCAGTGTCGATGAAACATTGAGAACACTTCAG
GCATTGCAATTTGTACAAGAGAACCCGGATGAGGTATGC
CCGGCTGGATGGAAGCCCGGGGAGAAGTCGATGAAGCCCGACCCTAAGGGCAGCAAGGAATACTTTGCAGCCAT

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGACACTCCA CCAAACCCCC CACAAAATCC CTATCTTCAT CTATTATCCA CATCAACAAC AACAACAACA ATAACAATGG CTTGTTCTTC ATCTGCTGCT TCCGCAACTC TTCTTTCTTC  CTTAAACCCT AGATCTTCTT CTTCCTCCTC TTTCATTTCC CCCAAGCTTC AAACCCTAAG CTTCTCATCC TCTTCCTCCT TCAACTTCCA GTCAAAATCC CTCCGCTCCT CCGTCTCCCT  CCGCCGTTCC GCCGCTCGCC GGAATGCGTT CGTCGTCAAA GCTGGTCTGC CACTAGTTGG GAATCAGGCA CCGGACTTTG AAGCGGAGGC TGTTTTTGAT CAGGAGTTCA TCAAGGTTAA  GCTCTCTGAA TACATCGGCA AGAAATACGT CATTCTCTTT TTCTACCCTT TGGACTTCAC TTTTGTTTGT CCAACAGAAA TCACCGCATT CAGTGACCGA TATGCAGAAT TTGAGAAGAT  AAATACCGAG ATATTGGGCG TTTCCGTAGA CAGTGTGTTT TCCCACCTTG CATGGGTTCA AACAGATAGA AAATCTGGGG GTCTTGGTGA TTTGAACTAC CCACTGGTTT CCGATGTTAC  AAAATCGATT TCAAAAGCTT TTAACGTGTT GATTGAAGAC CAGGGAATAG CATTAAGAGG ACTTTTTATT ATTGACAAGG AAGGTGTTAT CCAACATTCC ACAATTAACA ATCTTGCCAT  CGGCCGCAGT GTCGATGAAA CATTGAGAAC ACTTCAGGCA TTGCAATTTG TACAAGAGAA CCCGGATGAG GTATGCCCGG CTGGATGGAA GCCCGGGGAG AAGTCGATGA AGCCCGACCC  TAAGGGCAGC AAGGAATACT TTGCAGCCAT ATAATTTGAT AGTAGTTTTT TCTGTTTTAA TGAGTTGAAT TTTGGGAGTT TTTTTTTCGG GTTATGGACT TGTTGAAACA AGAAAATGTG  ATCTGTTGTG TTTTATTACA TACATCAAAT GATTTGGCGT ATTACATAAA TATTTGAGGT ATTATATGAA TTTGGTCAAT TATAGGGATT CAAAACAGAA TTACTAAAAA ATTAGGAAAT 
AAATGGGTCA AATATACAAT AAATCCAG 

Retrieve as FASTA