Entry information : HaPrxQ01 (HanXRQChr12g0354281)
Entry ID 13665
Creation 2016-05-11 (Christophe Dunand)
Last sequence changes 2016-05-11 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2017-11-23 (Catherine Mathe (Scipio))
Peroxidase information: HaPrxQ01 (HanXRQChr12g0354281)
Name (synonym) HaPrxQ01 (HanXRQChr12g0354281)
Class Atypical 2-Cysteine peroxiredoxin (type Q)    [Orthogroup: PrxQ001]
Taxonomy Eukaryota Viridiplantae Streptophyta Asteraceae Helianthus
Organism Helianthus annuus (Sunflower)    [TaxId: 4232 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HaPrxQ01
start..stop
S start..stop
PtPrxQ01 311 4e-109 1..217 1..213
PbPrxQ01 311 4e-109 1..217 1..214
EglPrxQ01 312 5e-109 4..216 60..267
EgrPrxQ01 313 9e-109 4..216 88..295
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 702646..702852 207 N° 2 702940..703077 138 N° 3 703781..703870 90 N° 4 703942..704157 216
join(702646..702852,702940..703077,703781..703870,703942..704157)


exon

Literature and cross-references HaPrxQ01 (HanXRQChr12g0354281)
DNA ref. HanXRQ genome:   HanXRQChr12 (702646..704157)
Protein sequence: HaPrxQ01 (HanXRQChr12g0354281)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   217
PWM (Da):   %s   23312.18  
PI (pH):   %s   10.21
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASTLAKHLLPSSLLPTTCNSTQSPKHHPSAAAAFRSHFHGLKLSISTTPSSGLTSSKASLLLTVVAGKVNKGSVPPSFTLKDQDGKSVSLSKFKGKPVVVYFYPADETPGCTKQACAFRDSYEKFKKAGAQVVGISGDDAASHKAFAKKYRLPFTLLSDEGNKVRKDWGVPSDLFGTLPGRQTYVLDKNGVVQLIYNNQFQPEKHVDETLKLLQSL

Retrieve as FASTA  
Remarks
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGTCGACTTTGGCAAAGCACCTTCTTCCTTCTTCTTTGCTCCCTACTACCTGTAACAGTACCCAATCCCCCAAACACCACCCATCTGCAGCAGCTGCATTCAGATCACACTTCCAT
GGCCTCAAGCTCTCTATCTCCACCACCCCTTCTTCTGGTTTGACCAGCAGCAAGGCTTCCCTCCTCCTCACTGTTGTTGCTGGAAAG
GTACGTACATTCATTCATTCATTCATATTTCCG
CTGGCTGCTCCATCTTACTAGTAATTCTCATTTTGTTTTGTTTTGTGTGTGTAGGTAAACAAAGGGTCTGTGCCCCCGTCTTTCACACTGAAAGATCAAGACGGTAAGAGTGTGAGCCTC
TCCAAGTTCAAAGGCAAGCCTGTTGTCGTCTATTTCTACCCTGCAGATGAAACCCCTGGCTGCACCAAACAG
GTACATTCTAATCTCTTTCATTCATCATTACCTATCTATCTATATATA
TATATATATATGCTCAACAGTTACGAATTCCTTCCACAACTTCTTGTGCTTATAATTGTGCAACAGAAATAACAGCTTTGTGGTAATGTTTCACGATACCATAGACAACTATCTATATAT
AAAACAAGATTGGGAATTTTGTATTTACAAAATGCTGATAGATTAACAACTAAATTAAACTAACAGTTTGACTCTGACTAAATTCTAACTCAAAAAGGTAGAACTACCAGCTGCCCCGCA
CCTCCTATCAGTGCACACATGCCTGCCTGCCTGAGTTCTCCCCTTGTTGTTTTTAAAACATTGACACCCATGCAATGTGGGTGACACTCCCAGCTTGGTTGTTGGATCTTCTTTCTGTCT
GGCTTCCAAACTTTATCCCCACCTTGGCTAAATTCTCTCTTAAAATGTTTGTAATACCAAATAGTCTAAAGAGTTGGGACCTCCTACGAAGGCATTTTGTACATCACTGAATCAAATACA
TGTAGAGAAGCCAGGGGAGGTCAAAACCATGAGTTGGCTTGCCTCAATCAATGAAGTAGTAAAACCAGAGATTGGAGATAATTTCATGCTCCCATTCCTCTTCTAGTATGACAAATTTAG
ATAGAAACAAGTAACAGAAAGTATGATTTAATTAGATTTGTGATGCAATGGGCAGGCATGCGCATTCAGGGACTCATACGAAAAATTCAAGAAAGCAGGCGCACAGGTCGTTGGGATCAG
CGGTGATGATGCAGCATCACACAAG
GTAAGCCATCACCAATCAGCTAGCTTATTTCATGCTATGTAAAATAAGGTAACGAAATTTTGTTTCTCTAGGCGTTTGCAAAGAAATACAGACTC
CCATTTACATTGCTGAGTGATGAGGGTAACAAAGTGAGAAAAGATTGGGGAGTTCCATCTGACCTTTTTGGTACATTGCCTGGTCGACAGACGTACGTTCTTGACAAGAATGGAGTTGTC
CAGCTTATCTATAACAACCAGTTTCAGCCTGAGAAGCACGTTGATGAGACCTTGAAGTTGCTTCAGAGTCTT

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGTCGACTTTGGCAAAGCACCTTCTTCCTTCTTCTTTGCTCCCTACTACCTGTAACAGTACCCAATCCCCCAAACACCACCCATCTGCAGCAGCTGCATTCAGATCACACTTCCAT
GGCCTCAAGCTCTCTATCTCCACCACCCCTTCTTCTGGTTTGACCAGCAGCAAGGCTTCCCTCCTCCTCACTGTTGTTGCTGGAAAG
GTAAACAAAGGGTCTGTGCCCCCGTCTTTCACA
CTGAAAGATCAAGACGGTAAGAGTGTGAGCCTCTCCAAGTTCAAAGGCAAGCCTGTTGTCGTCTATTTCTACCCTGCAGATGAAACCCCTGGCTGCACCAAACAG
GCATGCGCATTCAGG
GACTCATACGAAAAATTCAAGAAAGCAGGCGCACAGGTCGTTGGGATCAGCGGTGATGATGCAGCATCACACAAG
GCGTTTGCAAAGAAATACAGACTCCCATTTACATTGCTGAGTGAT
GAGGGTAACAAAGTGAGAAAAGATTGGGGAGTTCCATCTGACCTTTTTGGTACATTGCCTGGTCGACAGACGTACGTTCTTGACAAGAATGGAGTTGTCCAGCTTATCTATAACAACCAG
TTTCAGCCTGAGAAGCACGTTGATGAGACCTTGAAGTTGCTTCAGAGTCTT

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TTTCTTGTTT CACAGGAATT TCTGTATTTA TTTATTGAAA GTATAGATTT ATAGTGAGTA TTATGAAATA ACTTGGATGA GAAGCAGCCA CGTGGATGAA GAAATGTGAT GGGCATAACA  CATATTTACT TACTGGTGCA TCATCTCAAT CTCATCCGAA CTCAGCTGCT TCACCCTATC TATCTATCAA TCTATCTTTG CAAGTGAAGT GAATCAACAA TGGCGTCGAC TTTGGCAAAG  CACCTTCTTC CTTCTTCTTT GCTCCCTACT ACCTGTAACA GTACCCAATC CCCCAAACAC CACCCATCTG CAGCAGCTGC ATTCAGATCA CACTTCCATG GCCTCAAGCT CTCTATCTCC  ACCACCCCTT CTTCTGGTTT GACCAGCAGC AAGGCTTCCC TCCTCCTCAC TGTTGTTGCT GGAAAGGTAA ACAAAGGGTC TGTGCCCCCG TCTTTCACAC TGAAAGATCA AGACGGTAAG  AGTGTGAGCC TCTCCAAGTT CAAAGGCAAG CCTGTTGTCG TCTATTTCTA CCCTGCAGAT GAAACCCCTG GCTGCACCAA ACAGGCATGC GCATTCAGGG ACTCATACGA AAAATTCAAG  AAAGCAGGCG CACAGGTCGT TGGGATCAGC GGTGATGATG CAGCATCACA CAAGGCGTTT GCAAAGAAAT ACAGACTCCC ATTTACATTG CTGAGTGATG AGGGTAACAA AGTGAGAAAA  GATTGGGGAG TTCCATCTGA CCTTTTTGGT ACATTGCCTG GTCGACAGAC GTACGTTCTT GACAAGAATG GAGTTGTCCA GCTTATCTAT AACAACCAGT TTCAGCCTGA GAAGCACGTT  GATGAGACCT TGAAGTTGCT TCAGAGTCTT TAGTTTATTT ATTTAATCAA CCTCACCCAC CCACCACAGC TTTTGTAGAC AAACAACCAA ACATCTCGTC TATCTTATGT TGTGAATCAT  TCACTGATCG GTTGTACAAA TGATGAGCAA ACATATCTGT TCTACTATAT GCACGTTTCC AGAGTCTTCA CTGCTGCCCC CATTCCACTC CATGGAAGCC CACCAATCTG CTCATAAGGG  ATGGGTTCGC TTTAATAAAA AATACAGTTG TGTACCAATT TAAATGAATT CTTAGTTTAT GACAATTTAT CGTCTAAAAT ATTTCTTTAA CCTATTTTTG TGGGATCTCT AGTTCTTGAC  CACTCCATCC GACTACACGA ACTCACATCA GGGCAATAAA TCGCAGGTTA GTTTCTCGAT GATACAACGA TGGAAATCAT TTTGGTACAC CAATCGATTC AATTCTTCAT CATCATCATA 
CTCAGTAA 

Retrieve as FASTA